KEGG   Homo sapiens (human): 344Help
Entry
344               CDS       T01001                                 

Gene name
APOC2, APO-CII, APOC-II
Definition
(RefSeq) apolipoprotein C2
Organism
hsa  Homo sapiens (human)
Disease
H00154  
Hyperlipoproteinemia, type I
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 101 aa AA seqDB search
MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYE
KTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgggcacacgactcctcccagctctgtttcttgtcctcctggtattgggatttgaggtc
caggggacccaacagccccagcaagatgagatgcctagcccgaccttcctcacccaggtg
aaggaatctctctccagttactgggagtcagcaaagacagccgcccagaacctgtacgag
aagacatacctgcccgctgtagatgagaaactcagggacttgtacagcaaaagcacagca
gccatgagcacttacacaggcatttttactgaccaagttctttctgtgctgaagggagag
gagtaa

DBGET integrated database retrieval system