KEGG   Homo sapiens (human): 3440Help
Entry
3440              CDS       T01001                                 

Gene name
IFNA2, IFN-alphaA, IFNA, IFNA2B, INFA2
Definition
(RefSeq) interferon alpha 2
  KO
K05414  
interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Necroptosis
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Herpes simplex infection
Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3440 (IFNA2)
   04151 PI3K-Akt signaling pathway
    3440 (IFNA2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3440 (IFNA2)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    3440 (IFNA2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3440 (IFNA2)
   04621 NOD-like receptor signaling pathway
    3440 (IFNA2)
   04622 RIG-I-like receptor signaling pathway
    3440 (IFNA2)
   04623 Cytosolic DNA-sensing pathway
    3440 (IFNA2)
   04650 Natural killer cell mediated cytotoxicity
    3440 (IFNA2)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    3440 (IFNA2)
  Infectious diseases
   05152 Tuberculosis
    3440 (IFNA2)
   05162 Measles
    3440 (IFNA2)
   05164 Influenza A
    3440 (IFNA2)
   05161 Hepatitis B
    3440 (IFNA2)
   05160 Hepatitis C
    3440 (IFNA2)
   05168 Herpes simplex infection
    3440 (IFNA2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    3440 (IFNA2)
   05165 Human papillomavirus infection
    3440 (IFNA2)
Cytokines [BR:hsa04052]
 Class II cytokines (interferon/IL-10 family)
  Type I interferons
   3440 (IFNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P01563(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9p21.3
AA seq 188 aa AA seqDB search
MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFG
FPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEA
CVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNL
QESLRSKE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggccttgacctttgctttactggtggccctcctggtgctcagctgcaagtcaagctgc
tctgtgggctgtgatctgcctcaaacccacagcctgggtagcaggaggaccttgatgctc
ctggcacagatgaggagaatctctcttttctcctgcttgaaggacagacatgactttgga
tttccccaggaggagtttggcaaccagttccaaaaggctgaaaccatccctgtcctccat
gagatgatccagcagatcttcaatctcttcagcacaaaggactcatctgctgcttgggat
gagaccctcctagacaaattctacactgaactctaccagcagctgaatgacctggaagcc
tgtgtgatacagggggtgggggtgacagagactcccctgatgaaggaggactccattctg
gctgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagccct
tgtgcctgggaggttgtcagagcagaaatcatgagatctttttctttgtcaacaaacttg
caagaaagtttaagaagtaaggaatga

DBGET integrated database retrieval system