KEGG   Homo sapiens (human): 3446Help
Entry
3446              CDS       T01001                                 

Gene name
IFNA10, IFN-alphaC
Definition
(RefSeq) interferon alpha 10
  KO
K05414  
interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Necroptosis
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Herpes simplex infection
Pathways in cancer
Autoimmune thyroid disease
Network
N00148  
TLR3-IRF7 signaling pathway
N00150  
Type I IFN signaling pathway
N00162  
KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  
KSHV KIE1/2 to TLR3-IRF7 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3446 (IFNA10)
   04151 PI3K-Akt signaling pathway
    3446 (IFNA10)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3446 (IFNA10)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    3446 (IFNA10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3446 (IFNA10)
   04621 NOD-like receptor signaling pathway
    3446 (IFNA10)
   04622 RIG-I-like receptor signaling pathway
    3446 (IFNA10)
   04623 Cytosolic DNA-sensing pathway
    3446 (IFNA10)
   04650 Natural killer cell mediated cytotoxicity
    3446 (IFNA10)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3446 (IFNA10)
  Immune diseases
   05320 Autoimmune thyroid disease
    3446 (IFNA10)
  Infectious diseases
   05152 Tuberculosis
    3446 (IFNA10)
   05162 Measles
    3446 (IFNA10)
   05164 Influenza A
    3446 (IFNA10)
   05161 Hepatitis B
    3446 (IFNA10)
   05160 Hepatitis C
    3446 (IFNA10)
   05168 Herpes simplex infection
    3446 (IFNA10)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    3446 (IFNA10)
   05165 Human papillomavirus infection
    3446 (IFNA10)
Cytokines [BR:hsa04052]
 Class II cytokines (interferon/IL-10 family)
  Type I interferons
   3446 (IFNA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P01566(Tbio)
UniProt: 
Position
9p21.3
AA seq 189 aa AA seqDB search
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFR
IPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtccttttctttacttatggccgtgctggtgctcagctacaaatccatctgt
tctctaggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctgggacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttccga
atcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcatgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaatagagaggaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctcgttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

DBGET integrated database retrieval system