KEGG   Homo sapiens (human): 3456Help
Entry
3456              CDS       T01001                                 

Gene name
IFNB1, IFB, IFF, IFNB
Definition
interferon, beta 1, fibroblast
Orthology
K05415  
interferon beta
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Chagas disease (American trypanosomiasis)
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3456 (IFNB1)
   04151 PI3K-Akt signaling pathway
    3456 (IFNB1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3456 (IFNB1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3456 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    3456 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    3456 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    3456 (IFNB1)
  Development
   04380 Osteoclast differentiation
    3456 (IFNB1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    3456 (IFNB1)
   05162 Measles
    3456 (IFNB1)
   05164 Influenza A
    3456 (IFNB1)
   05161 Hepatitis B
    3456 (IFNB1)
   05160 Hepatitis C
    3456 (IFNB1)
   05168 Herpes simplex infection
    3456 (IFNB1)
   05142 Chagas disease (American trypanosomiasis)
    3456 (IFNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p21
AA seq 187 aa AA seqDB search
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
LTGYLRN
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctctt
tccatgagctacaacttgcttggattcctacaaagaagcagcaattttcagtgtcagaag
ctcctgtggcaattgaatgggaggcttgaatactgcctcaaggacaggatgaactttgac
atccctgaggagattaagcagctgcagcagttccagaaggaggacgccgcattgaccatc
tatgagatgctccagaacatctttgctattttcagacaagattcatctagcactggctgg
aatgagactattgttgagaacctcctggctaatgtctatcatcagataaaccatctgaag
acagtcctggaagaaaaactggagaaagaagatttcaccaggggaaaactcatgagcagt
ctgcacctgaaaagatattatgggaggattctgcattacctgaaggccaaggagtacagt
cactgtgcctggaccatagtcagagtggaaatcctaaggaacttttacttcattaacaga
cttacaggttacctccgaaactga

DBGET integrated database retrieval system