KEGG   Homo sapiens (human): 3458Help
Entry
3458              CDS       T01001                                 

Gene name
IFNG, IFG, IFI
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa04060  Cytokine-cytokine receptor interaction
hsa04066  HIF-1 signaling pathway
hsa04217  Necroptosis
hsa04350  TGF-beta signaling pathway
hsa04380  Osteoclast differentiation
hsa04612  Antigen processing and presentation
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04940  Type I diabetes mellitus
hsa05132  Salmonella infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05418  Fluid shear stress and atherosclerosis
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00083  Allograft rejection
H00084  Graft-versus-host disease
H01132  Aplastic anemia (AA)
Drug target
Fontolizumab: D04242
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    3458 (IFNG)
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    3458 (IFNG)
   04630 Jak-STAT signaling pathway
    3458 (IFNG)
   04066 HIF-1 signaling pathway
    3458 (IFNG)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3458 (IFNG)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    3458 (IFNG)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3458 (IFNG)
   04612 Antigen processing and presentation
    3458 (IFNG)
   04660 T cell receptor signaling pathway
    3458 (IFNG)
   04658 Th1 and Th2 cell differentiation
    3458 (IFNG)
   04659 Th17 cell differentiation
    3458 (IFNG)
   04657 IL-17 signaling pathway
    3458 (IFNG)
  Development
   04380 Osteoclast differentiation
    3458 (IFNG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3458 (IFNG)
  Immune diseases
   05322 Systemic lupus erythematosus
    3458 (IFNG)
   05323 Rheumatoid arthritis
    3458 (IFNG)
   05321 Inflammatiory bowel disease (IBD)
    3458 (IFNG)
   05330 Allograft rejection
    3458 (IFNG)
   05332 Graft-versus-host disease
    3458 (IFNG)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3458 (IFNG)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3458 (IFNG)
  Infectious diseases
   05132 Salmonella infection
    3458 (IFNG)
   05152 Tuberculosis
    3458 (IFNG)
   05162 Measles
    3458 (IFNG)
   05164 Influenza A
    3458 (IFNG)
   05168 Herpes simplex infection
    3458 (IFNG)
   05169 Epstein-Barr virus infection
    3458 (IFNG)
   05146 Amoebiasis
    3458 (IFNG)
   05144 Malaria
    3458 (IFNG)
   05145 Toxoplasmosis
    3458 (IFNG)
   05140 Leishmaniasis
    3458 (IFNG)
   05142 Chagas disease (American trypanosomiasis)
    3458 (IFNG)
   05143 African trypanosomiasis
    3458 (IFNG)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3458 (IFNG)
Cytokines [BR:hsa04052]
 Class II cytokines (interferon/IL-10 family)
  Type II interferons
   3458 (IFNG)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines (General comment) Chemotaxis, singal transduction, inflammation
   3458 (IFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IFN-gamma API5 Tup_N
Motif
Other DBs
NCBI-GeneID: 3458
NCBI-ProteinID: NP_000610
OMIM: 147570
HGNC: 5438
Ensembl: ENSG00000111537
Vega: OTTHUMG00000169113
Pharos: P01579(Tbio)
UniProt: P01579
Structure
PDB: 

Jmol
Position
12q15
AA seq 166 aa AA seqDB search
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatacaagttatatcttggcttttcagctctgcatcgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca
ggtcattcagatgtagcggataatggaactcttttcttaggcattttgaagaattggaaa
gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt
aaaaactttaaagatgaccagagcatccaaaagagtgtggagaccatcaaggaagacatg
aatgtcaagtttttcaatagcaacaaaaagaaacgagatgacttcgaaaagctgactaat
tattcggtaactgacttgaatgtccaacgcaaagcaatacatgaactcatccaagtgatg
gctgaactgtcgccagcagctaaaacagggaagcgaaaaaggagtcagatgctgtttcga
ggtcgaagagcatcccagtaa

DBGET integrated database retrieval system