KEGG   Homo sapiens (human): 3460Help
Entry
3460              CDS       T01001                                 

Gene name
IFNGR2, AF-1, IFGR2, IFNGT1, IMD28
Definition
interferon gamma receptor 2 (interferon gamma transducer 1)
Orthology
K05133  
interferon gamma receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
Osteoclast differentiation
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Salmonella infection
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Inflammatory bowel disease (IBD)
Disease
H00089  
IFN-gamma/IL-12 axis
H00342  
Tuberculosis
Drug target
Interferon gamma: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3460 (IFNGR2)
   04066 HIF-1 signaling pathway
    3460 (IFNGR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3460 (IFNGR2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3460 (IFNGR2)
  Development
   04380 Osteoclast differentiation
    3460 (IFNGR2)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    3460 (IFNGR2)
  Infectious diseases
   05132 Salmonella infection
    3460 (IFNGR2)
   05152 Tuberculosis
    3460 (IFNGR2)
   05162 Measles
    3460 (IFNGR2)
   05164 Influenza A
    3460 (IFNGR2)
   05168 Herpes simplex infection
    3460 (IFNGR2)
   05145 Toxoplasmosis
    3460 (IFNGR2)
   05140 Leishmaniasis
    3460 (IFNGR2)
   05142 Chagas disease (American trypanosomiasis)
    3460 (IFNGR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.11
AA seq 337 aa AA seqDB search
MRPTLLWSLLLLLGVFAAAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRP
VVYQVQFKYTDSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELG
ALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYW
EKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMAD
ASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQ
PILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccgacgctgctgtggtcgctgctgctgctgctcggagtcttcgccgccgccgcc
gcggccccgccagaccctctttcccagctgcccgctcctcagcacccgaagattcgcctg
tacaacgcagagcaggtcctgagttgggagccagtggccctgagcaatagcacgaggcct
gttgtctaccaagtgcagtttaaatacaccgacagtaaatggttcacggccgacatcatg
tccataggggtgaattgtacacagatcacagcaacagagtgtgacttcactgccgccagt
ccctcagcaggcttcccaatggatttcaatgtcactctacgccttcgagctgagctggga
gcactccattctgcctgggtgacaatgccttggtttcaacactatcggaatgtgactgtc
gggcctccagaaaacattgaggtgaccccaggagaaggctccctcatcatcaggttctcc
tctccctttgacatcgctgatacctccacggcctttttttgttattatgtccattactgg
gaaaaaggaggaatccaacaggtcaaaggccctttcagaagcaactccatttcattggat
aacttaaaaccctccagagtgtactgtttacaagtccaggcacaactgctttggaacaaa
agtaacatctttagagtcgggcatttaagcaacatatcttgctacgaaacaatggcagat
gcctccactgagcttcagcaagtcatcctgatctccgtgggaacattttcgttgctgtcg
gtgctggcaggagcctgtttcttcctggtcctgaaatatagaggcctgattaaatactgg
tttcacactccaccaagcatcccattacagatagaagagtatttaaaagacccaactcag
cccatcttagaggccttggacaaggacagctcaccaaaggatgacgtctgggactctgtg
tccattatctcgtttccggaaaaggagcaagaagatgttctccaaacgctttga

DBGET integrated database retrieval system