KEGG   Homo sapiens (human): 3460Help
Entry
3460              CDS       T01001                                 

Gene name
IFNGR2, AF-1, IFGR2, IFNGT1
Definition
interferon gamma receptor 2 (interferon gamma transducer 1)
Orthology
K05133  
interferon gamma receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
Osteoclast differentiation
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Salmonella infection
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Inflammatory bowel disease (IBD)
Disease
H00089  
IFN-gamma/IL-12 axis
H00342  
Tuberculosis
Drug target
Interferon gamma: 
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.11
AA seq 337 aa AA seqDB search
MRPTLLWSLLLLLGVFAAAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRP
VVYQVQFKYTDSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELG
ALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYW
EKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMAD
ASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQ
PILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccgacgctgctgtggtcgctgctgctgctgctcggagtcttcgccgccgccgcc
gcggccccgccagaccctctttcccagctgcccgctcctcagcacccgaagattcgcctg
tacaacgcagagcaggtcctgagttgggagccagtggccctgagcaatagcacgaggcct
gttgtctaccaagtgcagtttaaatacaccgacagtaaatggttcacggccgacatcatg
tccataggggtgaattgtacacagatcacagcaacagagtgtgacttcactgccgccagt
ccctcagcaggcttcccaatggatttcaatgtcactctacgccttcgagctgagctggga
gcactccattctgcctgggtgacaatgccttggtttcaacactatcggaatgtgactgtc
gggcctccagaaaacattgaggtgaccccaggagaaggctccctcatcatcaggttctcc
tctccctttgacatcgctgatacctccacggcctttttttgttattatgtccattactgg
gaaaaaggaggaatccaacaggtcaaaggccctttcagaagcaactccatttcattggat
aacttaaaaccctccagagtgtactgtttacaagtccaggcacaactgctttggaacaaa
agtaacatctttagagtcgggcatttaagcaacatatcttgctacgaaacaatggcagat
gcctccactgagcttcagcaagtcatcctgatctccgtgggaacattttcgttgctgtcg
gtgctggcaggagcctgtttcttcctggtcctgaaatatagaggcctgattaaatactgg
tttcacactccaccaagcatcccattacagatagaagagtatttaaaagacccaactcag
cccatcttagaggccttggacaaggacagctcaccaaaggatgacgtctgggactctgtg
tccattatctcgtttccggaaaaggagcaagaagatgttctccaaacgctttga

DBGET integrated database retrieval system