KEGG   Homo sapiens (human): 347Help
Entry
347               CDS       T01001                                 

Gene name
APOD
Definition
(RefSeq) apolipoprotein D
  KO
K03098  apolipoprotein D and lipocalin family protein
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   347 (APOD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin_2 Lipocalin Triabin LRV
Motif
Other DBs
NCBI-GeneID: 347
NCBI-ProteinID: NP_001638
OMIM: 107740
HGNC: 612
Ensembl: ENSG00000189058
Vega: OTTHUMG00000155854
Pharos: P05090(Tbio)
UniProt: P05090
Structure
PDB: 

Jmol
Position
3q29
AA seq 189 aa AA seqDB search
MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGR
CIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWI
LATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVT
DQVNCPKLS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgctgctgctgctgctttccgcactggctggcctcttcggtgcggcagaggga
caagcatttcatcttgggaagtgccccaatcctccggtgcaggagaattttgacgtgaat
aagtatctcggaagatggtacgaaattgagaagatcccaacaacctttgagaatggacgc
tgcatccaggccaactactcactaatggaaaacggaaagatcaaagtgttaaaccaggag
ttgagagctgatggaactgtgaatcaaatcgaaggtgaagccaccccagttaacctcaca
gagcctgccaagctggaagttaagttttcctggtttatgccatcggcaccgtactggatc
ctggccaccgactatgagaactatgccctcgtgtattcctgtacctgcatcatccaactt
tttcacgtggattttgcttggatcttggcaagaaaccctaatctccctccagaaacagtg
gactctctaaaaaatatcctgacttctaataacattgatgtcaagaaaatgacggtcaca
gaccaggtgaactgccccaagctctcgtaa

DBGET integrated database retrieval system