KEGG   Homo sapiens (human): 347688Help
Entry
347688            CDS       T01001                                 

Gene name
TUBB8, bA631M21.2
Definition
tubulin, beta 8 class VIII
Orthology
K07375  
tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Drug target
Podophyllotoxin: 
Vinblastine: 
Vincristine: 
Vindesine: 
Vinorelbine: 
Vintafolide: 
Paclitaxel: 
Docetaxel: 
Paclitaxel poliglumex: 
Eribulin: 
Colchicine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    347688 (TUBB8)
  Cell communication
   04540 Gap junction
    347688 (TUBB8)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    347688 (TUBB8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   347688 (TUBB8)
  Exosomal proteins of colorectal cancer cells
   347688 (TUBB8)
  Exosomal proteins of bladder cancer cells
   347688 (TUBB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
10p15.3
AA seq 444 aa AA seqDB search
MREIVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVYYNEASGGRYV
PRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGHYTEGAELMESVMDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSDTVV
EPYNATLSVHQLIENADETFCIDNEALYDICSKTLKLPTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMM
AACDPRHGRYLTAAAIFRGRMPMREVDEQMFNIQDKNSSYFADWLPNNVKTAVCDIPPRG
LKMSATFIGNNTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEEDEEYAEEEVA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagggagatcgtgctcacgcagatcgggcagtgcgggaatcagatcggcgccaagttc
tgggaggtgatctctgatgaacatgccatcgactccgctggcacctaccacggggacagc
cacctgcagctggagcgcatcaacgtgtactacaacgaggccagcggtggcaggtacgtg
ccccgcgctgtgctcgtggatctggagccgggcaccatggactctgtgcgctcggggccc
ttcgggcaggtcttcaggccagacaacttcatcttcggtcagtgtggggccggaaacaac
tgggccaagggacactacaccgaaggcgcggagctgatggagtcagtgatggacgttgtc
agaaaggaggctgagagctgtgactgcctgcagggtttccagctgacccactccctgggt
ggggggactgggtctgggatgggtacccttctgctcagtaagatccgggaggagtaccca
gacaggatcataaacacattcagcatcctgccctcgcccaaggtgtcggacaccgtggtg
gagccctacaacgccaccctctcagtccaccagctcatagaaaacgcagatgagaccttt
tgcatagataacgaagctctgtatgacatatgttccaagaccctaaaactgcccacaccc
acctatggtgacctgaaccacctggtgtctgctaccatgagtggggtcaccacgtgcctg
cgcttcccgggccagctgaatgctgacctgcggaagctggccgtgaacatggtcccgttt
ccccggctgcatttcttcatgcccggctttgccccactgaccagccggggcagccagcag
taccgggccttgactgtggctgagcttacccagcagatgtttgatgctaagaacatgatg
gctgcctgtgacccccgtcacggccgctacctaacggcggctgccattttcaggggtcgc
atgcccatgagggaggtggatgaacaaatgttcaacattcaagataagaacagcagttac
tttgctgactggctccccaacaacgtaaaaacagccgtctgtgacatcccaccccggggg
ctaaaaatgtcagccaccttcattgggaataatacggccatccaggaactcttcaagcgt
gtctcagagcagtttacagcaatgttcaggcgcaaggccttcctccactggtacacgggc
gagggcatggatgagatggaattcaccgaggccgagagcaacatgaacgacctggtgtct
gaatatcagcaatatcaggatgccacggccgaggaggaggaggatgaggagtatgccgag
gaggaggtggcctag

DBGET integrated database retrieval system