KEGG   Homo sapiens (human): 3479Help
Entry
3479              CDS       T01001                                 

Gene name
IGF1, IGF-I, IGF1A, IGFI
Definition
insulin-like growth factor 1 (somatomedin C)
Orthology
K05459  
insulin-like growth factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Oocyte meiosis
p53 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Focal adhesion
Long-term depression
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Aldosterone-regulated sodium reabsorption
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
Glioma
Prostate cancer
Melanoma
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00015  
Malignant pleural mesothelioma
H00254  
Pituitary Dwarfism (PD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3479 (IGF1)
   04015 Rap1 signaling pathway
    3479 (IGF1)
   04066 HIF-1 signaling pathway
    3479 (IGF1)
   04068 FoxO signaling pathway
    3479 (IGF1)
   04151 PI3K-Akt signaling pathway
    3479 (IGF1)
   04152 AMPK signaling pathway
    3479 (IGF1)
   04150 mTOR signaling pathway
    3479 (IGF1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    3479 (IGF1)
   04115 p53 signaling pathway
    3479 (IGF1)
  Cell communication
   04510 Focal adhesion
    3479 (IGF1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    3479 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    3479 (IGF1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3479 (IGF1)
  Nervous system
   04730 Long-term depression
    3479 (IGF1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3479 (IGF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3479 (IGF1)
   05202 Transcriptional misregulation in cancers
    3479 (IGF1)
   05205 Proteoglycans in cancer
    3479 (IGF1)
   05214 Glioma
    3479 (IGF1)
   05218 Melanoma
    3479 (IGF1)
   05215 Prostate cancer
    3479 (IGF1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3479 (IGF1)
   05414 Dilated cardiomyopathy (DCM)
    3479 (IGF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q23.2
AA seq 153 aa AA seqDB search
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcgctgtgcctgctc
accttcaccagctctgccacggctggaccggagacgctctgcggggctgagctggtggat
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtatggc
tccagcagtcggagggcgcctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctaaggaggctggagatgtattgcgcacccctcaagcctgccaagtcagctcgctct
gtccgtgcccagcgccacaccgacatgcccaagacccagaaggaagtacatttgaagaac
gcaagtagagggagtgcaggaaacaagaactacaggatgtag

DBGET integrated database retrieval system