KEGG   Homo sapiens (human): 3480Help
Entry
3480              CDS       T01001                                 

Gene name
IGF1R, CD221, IGFIR, IGFR, JTK13
Definition
insulin-like growth factor 1 receptor (EC:2.7.10.1)
Orthology
K05087  
insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Oocyte meiosis
Endocytosis
PI3K-Akt signaling pathway
AMPK signaling pathway
Focal adhesion
Adherens junction
Long-term depression
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
Glioma
Prostate cancer
Melanoma
Disease
H00015  
Malignant pleural mesothelioma
H00050  
Synovial sarcoma
H01274  
Growth delay due to insulin-like growth factor I resistance
Drug target
Mecasermin: 
Mecasermin rinfabate: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3480 (IGF1R)
   04015 Rap1 signaling pathway
    3480 (IGF1R)
   04066 HIF-1 signaling pathway
    3480 (IGF1R)
   04068 FoxO signaling pathway
    3480 (IGF1R)
   04151 PI3K-Akt signaling pathway
    3480 (IGF1R)
   04152 AMPK signaling pathway
    3480 (IGF1R)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3480 (IGF1R)
  Cell growth and death
   04114 Oocyte meiosis
    3480 (IGF1R)
  Cell communication
   04510 Focal adhesion
    3480 (IGF1R)
   04520 Adherens junction
    3480 (IGF1R)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    3480 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    3480 (IGF1R)
  Nervous system
   04730 Long-term depression
    3480 (IGF1R)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3480 (IGF1R)
   05202 Transcriptional misregulation in cancers
    3480 (IGF1R)
   05205 Proteoglycans in cancer
    3480 (IGF1R)
   05214 Glioma
    3480 (IGF1R)
   05218 Melanoma
    3480 (IGF1R)
   05215 Prostate cancer
    3480 (IGF1R)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     3480 (IGF1R)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  InsR family [OT]
   3480 (IGF1R)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class II (Insulin receptor family)
   3480 (IGF1R)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   3480 (IGF1R)
Cellular antigens [BR:hsa04090]
 Proteins
  3480 (IGF1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q26.3
AA seq 1367 aa AA seqDB search
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4104 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcctgtttctctcc
gccgcgctctcgctctggccgacgagtggagaaatctgcgggccaggcatcgacatccgc
aacgactatcagcagctgaagcgcctggagaactgcacggtgatcgagggctacctccac
atcctgctcatctccaaggccgaggactaccgcagctaccgcttccccaagctcacggtc
attaccgagtacttgctgctgttccgagtggctggcctcgagagcctcggagacctcttc
cccaacctcacggtcatccgcggctggaaactcttctacaactacgccctggtcatcttc
gagatgaccaatctcaaggatattgggctttacaacctgaggaacattactcggggggcc
atcaggattgagaaaaatgctgacctctgttacctctccactgtggactggtccctgatc
ctggatgcggtgtccaataactacattgtggggaataagcccccaaaggaatgtggggac
ctgtgtccagggaccatggaggagaagccgatgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaaccgctgccagaaaatgtgcccaagcacgtgtggg
aagcgggcgtgcaccgagaacaatgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcctgacaacgacacggcctgtgtagcttgccgccactactactatgccggtgtctgt
gtgcctgcctgcccgcccaacacctacaggtttgagggctggcgctgtgtggaccgtgac
ttctgcgccaacatcctcagcgccgagagcagcgactccgaggggtttgtgatccacgac
ggcgagtgcatgcaggagtgcccctcgggcttcatccgcaacggcagccagagcatgtac
tgcatcccttgtgaaggtccttgcccgaaggtctgtgaggaagaaaagaaaacaaagacc
attgattctgttacttctgctcagatgctccaaggatgcaccatcttcaagggcaatttg
ctcattaacatccgacgggggaataacattgcttcagagctggagaacttcatggggctc
atcgaggtggtgacgggctacgtgaagatccgccattctcatgccttggtctccttgtcc
ttcctaaaaaaccttcgcctcatcctaggagaggagcagctagaagggaattactccttc
tacgtcctcgacaaccagaacttgcagcaactgtgggactgggaccaccgcaacctgacc
atcaaagcagggaaaatgtactttgctttcaatcccaaattatgtgtttccgaaatttac
cgcatggaggaagtgacggggactaaagggcgccaaagcaaaggggacataaacaccagg
aacaacggggagagagcctcctgtgaaagtgacgtcctgcatttcacctccaccaccacg
tcgaagaatcgcatcatcataacctggcaccggtaccggccccctgactacagggatctc
atcagcttcaccgtttactacaaggaagcaccctttaagaatgtcacagagtatgatggg
caggatgcctgcggctccaacagctggaacatggtggacgtggacctcccgcccaacaag
gacgtggagcccggcatcttactacatgggctgaagccctggactcagtacgccgtttac
gtcaaggctgtgaccctcaccatggtggagaacgaccatatccgtggggccaagagtgag
atcttgtacattcgcaccaatgcttcagttccttccattcccttggacgttctttcagca
tcgaactcctcttctcagttaatcgtgaagtggaaccctccctctctgcccaacggcaac
ctgagttactacattgtgcgctggcagcggcagcctcaggacggctacctttaccggcac
aattactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccatcgacatt
gaggaggtcacagagaaccccaagactgaggtgtgtggtggggagaaagggccttgctgc
gcctgccccaaaactgaagccgagaagcaggccgagaaggaggaggctgaataccgcaaa
gtctttgagaatttcctgcacaactccatcttcgtgcccagacctgaaaggaagcggaga
gatgtcatgcaagtggccaacaccaccatgtccagccgaagcaggaacaccacggccgca
gacacctacaacatcaccgacccggaagagctggagacagagtaccctttctttgagagc
agagtggataacaaggagagaactgtcatttctaaccttcggcctttcacattgtaccgc
atcgatatccacagctgcaaccacgaggctgagaagctgggctgcagcgcctccaacttc
gtctttgcaaggactatgcccgcagaaggagcagatgacattcctgggccagtgacctgg
gagccaaggcctgaaaactccatctttttaaagtggccggaacctgagaatcccaatgga
ttgattctaatgtatgaaataaaatacggatcacaagttgaggatcagcgagaatgtgtg
tccagacaggaatacaggaagtatggaggggccaagctaaaccggctaaacccggggaac
tacacagcccggattcaggccacatctctctctgggaatgggtcgtggacagatcctgtg
ttcttctatgtccaggccaaaacaggatatgaaaacttcatccatctgatcatcgctctg
cccgtcgctgtcctgttgatcgtgggagggttggtgattatgctgtacgtcttccataga
aagagaaataacagcaggctggggaatggagtgctgtatgcctctgtgaacccggagtac
ttcagcgctgctgatgtgtacgttcctgatgagtgggaggtggctcgggagaagatcacc
atgagccgggaacttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggt
gtggtgaaagatgaacctgaaaccagagtggccattaaaacagtgaacgaggccgcaagc
atgcgtgagaggattgagtttctcaacgaagcttctgtgatgaaggagttcaattgtcac
catgtggtgcgattgctgggtgtggtgtcccaaggccagccaacactggtcatcatggaa
ctgatgacacggggcgatctcaaaagttatctccggtctctgaggccagaaatggagaat
aatccagtcctagcacctccaagcctgagcaagatgattcagatggccggagagattgca
gacggcatggcatacctcaacgccaataagttcgtccacagagaccttgctgcccggaat
tgcatggtagccgaagatttcacagtcaaaatcggagattttggtatgacgcgagatatc
tatgagacagactattaccggaaaggagggaaagggctgctgcccgtgcgctggatgtct
cctgagtccctcaaggatggagtcttcaccacttactcggacgtctggtccttcggggtc
gtcctctgggagatcgccacactggccgagcagccctaccagggcttgtccaacgagcaa
gtccttcgcttcgtcatggagggcggccttctggacaagccagacaactgtcctgacatg
ctgtttgaactgatgcgcatgtgctggcagtataaccccaagatgaggccttccttcctg
gagatcatcagcagcatcaaagaggagatggagcctggcttccgggaggtctccttctac
tacagcgaggagaacaagctgcccgagccggaggagctggacctggagccagagaacatg
gagagcgtccccctggacccctcggcctcctcgtcctccctgccactgcccgacagacac
tcaggacacaaggccgagaacggccccggccctggggtgctggtcctccgcgccagcttc
gacgagagacagccttacgcccacatgaacgggggccgcaagaacgagcgggccttgccg
ctgccccagtcttcgacctgctga

DBGET integrated database retrieval system