KEGG   Homo sapiens (human): 3487Help
Entry
3487              CDS       T01001                                 

Gene name
IGFBP4, BP-4, HT29-IGFBP, IBP4, IGFBP-4
Definition
(RefSeq) insulin like growth factor binding protein 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.2
AA seq 258 aa AA seqDB search
MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCA
LGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDE
GDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHR
ALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGG
LEPKGELDCHQLADSFRE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccctctgcctcgtggccgccctgctgctggccgccgggcccgggccgagcctg
ggcgacgaagccatccactgcccgccctgctccgaggagaagctggcgcgctgccgcccc
cccgtgggctgcgaggagctggtgcgagagccgggctgcggctgttgcgccacttgcgcc
ctgggcttggggatgccctgcggggtgtacaccccccgttgcggctcgggcctgcgctgc
tacccgccccgaggggtggagaagcccctgcacacactgatgcacgggcaaggcgtgtgc
atggagctggcggagatcgaggccatccaggaaagcctgcagccctctgacaaggacgag
ggtgaccaccccaacaacagcttcagcccctgtagcgcccatgaccgcaggtgcctgcag
aagcacttcgccaaaattcgagaccggagcaccagtgggggcaagatgaaggtcaatggg
gcgccccgggaggatgcccggcctgtgccccagggctcctgccagagcgagctgcaccgg
gcgctggagcggctggccgcttcacagagccgcacccacgaggacctctacatcatcccc
atccccaactgcgaccgcaacggcaacttccaccccaagcagtgtcacccagctctggat
gggcagcgtggcaagtgctggtgtgtggaccggaagacgggggtgaagcttccggggggc
ctggagccaaagggggagctggactgccaccagctggctgacagctttcgagagtga

DBGET integrated database retrieval system