KEGG   Homo sapiens (human): 355Help
Entry
355               CDS       T01001                                 

Gene name
FAS, ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
Definition
Fas cell surface death receptor
Orthology
K04390  
tumor necrosis factor receptor superfamily member 6
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
p53 signaling pathway
Apoptosis
Natural killer cell mediated cytotoxicity
TNF signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Alzheimer's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Pathways in cancer
Proteoglycans in cancer
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Disease
H00005  
Chronic lymphocytic leukemia (CLL)
H00007  
Hodgkin lymphoma
H00009  
Adult T-cell leukemia
H00017  
Esophageal cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
Human Diseases; Immune diseases; Allograft rejection [PATH:hsa05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:hsa05332]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:hsa04940]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:hsa05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.1
AA seq 335 aa AA seqDB search
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL
LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM
TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK
ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcatctggaccctcctacctctggttcttacgtctgttgctagattatcgtcc
aaaagtgttaatgcccaagtgactgacatcaactccaagggattggaattgaggaagact
gttactacagttgagactcagaacttggaaggcctgcatcatgatggccaattctgccat
aagccctgtcctccaggtgaaaggaaagctagggactgcacagtcaatggggatgaacca
gactgcgtgccctgccaagaagggaaggagtacacagacaaagcccatttttcttccaaa
tgcagaagatgtagattgtgtgatgaaggacatggcttagaagtggaaataaactgcacc
cggacccagaataccaagtgcagatgtaaaccaaactttttttgtaactctactgtatgt
gaacactgtgacccttgcaccaaatgtgaacatggaatcatcaaggaatgcacactcacc
agcaacaccaagtgcaaagaggaaggatccagatctaacttggggtggctttgtcttctt
cttttgccaattccactaattgtttgggtgaagagaaaggaagtacagaaaacatgcaga
aagcacagaaaggaaaaccaaggttctcatgaatctccaactttaaatcctgaaacagtg
gcaataaatttatctgatgttgacttgagtaaatatatcaccactattgctggagtcatg
acactaagtcaagttaaaggctttgttcgaaagaatggtgtcaatgaagccaaaatagat
gagatcaagaatgacaatgtccaagacacagcagaacagaaagttcaactgcttcgtaat
tggcatcaacttcatggaaagaaagaagcgtatgacacattgattaaagatctcaaaaaa
gccaatctttgtactcttgcagagaaaattcagactatcatcctcaaggacattactagt
gactcagaaaattcaaacttcagaaatgaaatccaaagcttggtctag

DBGET integrated database retrieval system