KEGG   Homo sapiens (human): 355Help
Entry
355               CDS       T01001                                 

Gene name
FAS, ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
Definition
Fas cell surface death receptor
Orthology
K04390  
tumor necrosis factor receptor superfamily member 6
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
p53 signaling pathway
Apoptosis
Natural killer cell mediated cytotoxicity
TNF signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Alzheimer's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Pathways in cancer
Proteoglycans in cancer
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Disease
H00005  
Chronic lymphocytic leukemia (CLL)
H00007  
Hodgkin lymphoma
H00009  
Adult T-cell leukemia
H00017  
Esophageal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    355 (FAS)
   04668 TNF signaling pathway
    355 (FAS)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    355 (FAS)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    355 (FAS)
   04115 p53 signaling pathway
    355 (FAS)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    355 (FAS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    355 (FAS)
   05205 Proteoglycans in cancer
    355 (FAS)
  Immune diseases
   05320 Autoimmune thyroid disease
    355 (FAS)
   05330 Allograft rejection
    355 (FAS)
   05332 Graft-versus-host disease
    355 (FAS)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    355 (FAS)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    355 (FAS)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    355 (FAS)
  Infectious diseases
   05162 Measles
    355 (FAS)
   05164 Influenza A
    355 (FAS)
   05161 Hepatitis B
    355 (FAS)
   05168 Herpes simplex infection
    355 (FAS)
   05142 Chagas disease (American trypanosomiasis)
    355 (FAS)
   05143 African trypanosomiasis
    355 (FAS)
Cellular antigens [BR:hsa04090]
 Proteins
  355 (FAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.1
AA seq 335 aa AA seqDB search
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL
LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM
TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK
ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcatctggaccctcctacctctggttcttacgtctgttgctagattatcgtcc
aaaagtgttaatgcccaagtgactgacatcaactccaagggattggaattgaggaagact
gttactacagttgagactcagaacttggaaggcctgcatcatgatggccaattctgccat
aagccctgtcctccaggtgaaaggaaagctagggactgcacagtcaatggggatgaacca
gactgcgtgccctgccaagaagggaaggagtacacagacaaagcccatttttcttccaaa
tgcagaagatgtagattgtgtgatgaaggacatggcttagaagtggaaataaactgcacc
cggacccagaataccaagtgcagatgtaaaccaaactttttttgtaactctactgtatgt
gaacactgtgacccttgcaccaaatgtgaacatggaatcatcaaggaatgcacactcacc
agcaacaccaagtgcaaagaggaaggatccagatctaacttggggtggctttgtcttctt
cttttgccaattccactaattgtttgggtgaagagaaaggaagtacagaaaacatgcaga
aagcacagaaaggaaaaccaaggttctcatgaatctccaactttaaatcctgaaacagtg
gcaataaatttatctgatgttgacttgagtaaatatatcaccactattgctggagtcatg
acactaagtcaagttaaaggctttgttcgaaagaatggtgtcaatgaagccaaaatagat
gagatcaagaatgacaatgtccaagacacagcagaacagaaagttcaactgcttcgtaat
tggcatcaacttcatggaaagaaagaagcgtatgacacattgattaaagatctcaaaaaa
gccaatctttgtactcttgcagagaaaattcagactatcatcctcaaggacattactagt
gactcagaaaattcaaacttcagaaatgaaatccaaagcttggtctag

DBGET integrated database retrieval system