KEGG   Homo sapiens (human): 3551Help
Entry
3551              CDS       T01001                                 

Gene name
IKBKB, IKK-beta, IKK2, IKKB, IMD15, NFKBIKB
Definition
inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta (EC:2.7.11.10)
Orthology
K07209  
inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Hepatitis C
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
MicroRNAs in cancer
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Module
Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3551 (IKBKB)
   04010 MAPK signaling pathway
    3551 (IKBKB)
   04064 NF-kappa B signaling pathway
    3551 (IKBKB)
   04668 TNF signaling pathway
    3551 (IKBKB)
   04068 FoxO signaling pathway
    3551 (IKBKB)
   04151 PI3K-Akt signaling pathway
    3551 (IKBKB)
   04150 mTOR signaling pathway
    3551 (IKBKB)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    3551 (IKBKB)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3551 (IKBKB)
   04621 NOD-like receptor signaling pathway
    3551 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    3551 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    3551 (IKBKB)
   04660 T cell receptor signaling pathway
    3551 (IKBKB)
   04662 B cell receptor signaling pathway
    3551 (IKBKB)
   04062 Chemokine signaling pathway
    3551 (IKBKB)
  Endocrine system
   04910 Insulin signaling pathway
    3551 (IKBKB)
   04920 Adipocytokine signaling pathway
    3551 (IKBKB)
  Nervous system
   04722 Neurotrophin signaling pathway
    3551 (IKBKB)
  Development
   04380 Osteoclast differentiation
    3551 (IKBKB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3551 (IKBKB)
   05206 MicroRNAs in cancer
    3551 (IKBKB)
   05212 Pancreatic cancer
    3551 (IKBKB)
   05221 Acute myeloid leukemia
    3551 (IKBKB)
   05220 Chronic myeloid leukemia
    3551 (IKBKB)
   05215 Prostate cancer
    3551 (IKBKB)
   05222 Small cell lung cancer
    3551 (IKBKB)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    3551 (IKBKB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3551 (IKBKB)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3551 (IKBKB)
   05131 Shigellosis
    3551 (IKBKB)
   05166 HTLV-I infection
    3551 (IKBKB)
   05164 Influenza A
    3551 (IKBKB)
   05161 Hepatitis B
    3551 (IKBKB)
   05160 Hepatitis C
    3551 (IKBKB)
   05168 Herpes simplex infection
    3551 (IKBKB)
   05169 Epstein-Barr virus infection
    3551 (IKBKB)
   05145 Toxoplasmosis
    3551 (IKBKB)
   05142 Chagas disease (American trypanosomiasis)
    3551 (IKBKB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     3551 (IKBKB)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  IKK family [OT]
   3551 (IKBKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p11.2
AA seq 754 aa AA seqDB search
MFSGGCHSPGFGRPSPAFPAPGSPPPAPRPCRQETGEQIAIKQCRQELSPRNRERWCLEI
QIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAI
LTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSF
VGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVD
IVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCFKA
LDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALI
PDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLA
FFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAK
LDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQT
DIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFE
KKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKIAC
SKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLENA
IQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaggggggtgtcatagccccgggtttggccgccccagccccgccttccccgcc
ccggggagcccgccccctgccccgcgtccctgccgacaggaaacaggtgagcagattgcc
atcaagcagtgccggcaggagctcagcccccggaaccgagagcggtggtgcctggagatc
cagatcatgagaaggctgacccaccccaatgtggtggctgcccgagatgtccctgagggg
atgcagaacttggcgcccaatgacctgcccctgctggccatggagtactgccaaggagga
gatctccggaagtacctgaaccagtttgagaactgctgtggtctgcgggaaggtgccatc
ctcaccttgctgagtgacattgcctctgcgcttagataccttcatgaaaacagaatcatc
catcgggatctaaagccagaaaacatcgtcctgcagcaaggagaacagaggttaatacac
aaaattattgacctaggatatgccaaggagctggatcagggcagtctttgcacatcattc
gtggggaccctgcagtacctggccccagagctactggagcagcagaagtacacagtgacc
gtcgactactggagcttcggcaccctggcctttgagtgcatcacgggcttccggcccttc
ctccccaactggcagcccgtgcagtggcattcaaaagtgcggcagaagagtgaggtggac
attgttgttagcgaagacttgaatggaacggtgaagttttcaagctctttaccctacccc
aataatcttaacagtgtcctggctgagcgactggagaagtggctgcaactgatgctgatg
tggcacccccgacagaggggcacggatcccacgtatgggcccaatggctgcttcaaggcc
ctggatgacatcttaaacttaaagctggttcatatcttgaacatggtcacgggcaccatc
cacacctaccctgtgacagaggatgagagtctgcagagcttgaaggccagaatccaacag
gacacgggcatcccagaggaggaccaggagctgctgcaggaagcgggcctggcgttgatc
cccgataagcctgccactcagtgtatttcagacggcaagttaaatgagggccacacattg
gacatggatcttgtttttctctttgacaacagtaaaatcacctatgagactcagatctcc
ccacggccccaacctgaaagtgtcagctgtatccttcaagagcccaagaggaatctcgcc
ttcttccagctgaggaaggtgtggggccaggtctggcacagcatccagaccctgaaggaa
gattgcaaccggctgcagcagggacagcgagccgccatgatgaatctcctccgaaacaac
agctgcctctccaaaatgaagaattccatggcttccatgtctcagcagctcaaggccaag
ttggatttcttcaaaaccagcatccagattgacctggagaagtacagcgagcaaaccgag
tttgggatcacatcagataaactgctgctggcctggagggaaatggagcaggctgtggag
ctctgtgggcgggagaacgaagtgaaactcctggtagaacggatgatggctctgcagacc
gacattgtggacttacagaggagccccatgggccggaagcaggggggaacgctggacgac
ctagaggagcaagcaagggagctgtacaggagactaagggaaaaacctcgagaccagcga
actgagggtgacagtcaggaaatggtacggctgctgcttcaggcaattcagagcttcgag
aagaaagtgcgagtgatctatacgcagctcagtaaaactgtggtttgcaagcagaaggcg
ctggaactgttgcccaaggtggaagaggtggtgagcttaatgaatgaggatgagaagact
gttgtccggctgcaggagaagcggcagaaggagctctggaatctcctgaagattgcttgt
agcaaggtccgtggtcctgtcagtggaagcccggatagcatgaatgcctctcgacttagc
cagcctgggcagctgatgtctcagccctccacggcctccaacagcttacctgagccagcc
aagaagagtgaagaactggtggctgaagcacataacctctgcaccctgctagaaaatgcc
atacaggacactgtgagggaacaagaccagagtttcacggccctagactggagctggtta
cagacggaagaagaagagcacagctgcctggagcaggcctcatga

DBGET integrated database retrieval system