KEGG   Homo sapiens (human): 3552Help
Entry
3552              CDS       T01001                                 

Gene name
IL1A, IL-1A, IL1, IL1-ALPHA, IL1F1
Definition
interleukin 1, alpha
Orthology
K04383  
interleukin 1 alpha
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
Apoptosis
Osteoclast differentiation
Hematopoietic cell lineage
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Prion diseases
Salmonella infection
Pertussis
Leishmaniasis
Tuberculosis
Measles
Influenza A
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Graft-versus-host disease
Disease
H00084  
Graft-versus-host disease
Drug target
Rilonacept: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3552 (IL1A)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3552 (IL1A)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    3552 (IL1A)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3552 (IL1A)
  Development
   04380 Osteoclast differentiation
    3552 (IL1A)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    3552 (IL1A)
   05321 Inflammatiory bowel disease (IBD)
    3552 (IL1A)
   05332 Graft-versus-host disease
    3552 (IL1A)
  Neurodegenerative diseases
   05020 Prion diseases
    3552 (IL1A)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3552 (IL1A)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3552 (IL1A)
  Infectious diseases
   05132 Salmonella infection
    3552 (IL1A)
   05133 Pertussis
    3552 (IL1A)
   05152 Tuberculosis
    3552 (IL1A)
   05162 Measles
    3552 (IL1A)
   05164 Influenza A
    3552 (IL1A)
   05140 Leishmaniasis
    3552 (IL1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q14
AA seq 271 aa AA seqDB search
MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS
NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI
TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP
NLFIATKQDYWVCLAGGPPSITDFQILENQA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagttccagacatgtttgaagacctgaagaactgttacagtgaaaatgaagaa
gacagttcctccattgatcatctgtctctgaatcagaaatccttctatcatgtaagctat
ggcccactccatgaaggctgcatggatcaatctgtgtctctgagtatctctgaaacctct
aaaacatccaagcttaccttcaaggagagcatggtggtagtagcaaccaacgggaaggtt
ctgaagaagagacggttgagtttaagccaatccatcactgatgatgacctggaggccatc
gccaatgactcagaggaagaaatcatcaagcctaggtcagcaccttttagcttcctgagc
aatgtgaaatacaactttatgaggatcatcaaatacgaattcatcctgaatgacgccctc
aatcaaagtataattcgagccaatgatcagtacctcacggctgctgcattacataatctg
gatgaagcagtgaaatttgacatgggtgcttataagtcatcaaaggatgatgctaaaatt
accgtgattctaagaatctcaaaaactcaattgtatgtgactgcccaagatgaagaccaa
ccagtgctgctgaaggagatgcctgagatacccaaaaccatcacaggtagtgagaccaac
ctcctcttcttctgggaaactcacggcactaagaactatttcacatcagttgcccatcca
aacttgtttattgccacaaagcaagactactgggtgtgcttggcaggggggccaccctct
atcactgactttcagatactggaaaaccaggcgtag

DBGET integrated database retrieval system