KEGG   Homo sapiens (human): 3552Help
Entry
3552              CDS       T01001                                 

Gene name
IL1A, IL-1A, IL1, IL1-ALPHA, IL1F1
Definition
interleukin 1, alpha
Orthology
K04383  
interleukin 1 alpha
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
Apoptosis
Osteoclast differentiation
Hematopoietic cell lineage
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Prion diseases
Salmonella infection
Pertussis
Leishmaniasis
Tuberculosis
Measles
Influenza A
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Graft-versus-host disease
Disease
H00084  
Graft-versus-host disease
Drug target
Rilonacept: 
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:hsa05332]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:hsa05020]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:hsa04940]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q14
AA seq 271 aa AA seqDB search
MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS
NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI
TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP
NLFIATKQDYWVCLAGGPPSITDFQILENQA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagttccagacatgtttgaagacctgaagaactgttacagtgaaaatgaagaa
gacagttcctccattgatcatctgtctctgaatcagaaatccttctatcatgtaagctat
ggcccactccatgaaggctgcatggatcaatctgtgtctctgagtatctctgaaacctct
aaaacatccaagcttaccttcaaggagagcatggtggtagtagcaaccaacgggaaggtt
ctgaagaagagacggttgagtttaagccaatccatcactgatgatgacctggaggccatc
gccaatgactcagaggaagaaatcatcaagcctaggtcagcaccttttagcttcctgagc
aatgtgaaatacaactttatgaggatcatcaaatacgaattcatcctgaatgacgccctc
aatcaaagtataattcgagccaatgatcagtacctcacggctgctgcattacataatctg
gatgaagcagtgaaatttgacatgggtgcttataagtcatcaaaggatgatgctaaaatt
accgtgattctaagaatctcaaaaactcaattgtatgtgactgcccaagatgaagaccaa
ccagtgctgctgaaggagatgcctgagatacccaaaaccatcacaggtagtgagaccaac
ctcctcttcttctgggaaactcacggcactaagaactatttcacatcagttgcccatcca
aacttgtttattgccacaaagcaagactactgggtgtgcttggcaggggggccaccctct
atcactgactttcagatactggaaaaccaggcgtag

DBGET integrated database retrieval system