KEGG   Homo sapiens (human): 3552Help
Entry
3552              CDS       T01001                                 

Gene name
IL1A, IL-1A, IL1, IL1-ALPHA, IL1F1
Definition
(RefSeq) interleukin 1 alpha
  KO
K04383  interleukin 1 alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04380  Osteoclast differentiation
hsa04640  Hematopoietic cell lineage
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04940  Type I diabetes mellitus
hsa05020  Prion diseases
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05164  Influenza A
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05332  Graft-versus-host disease
hsa05418  Fluid shear stress and atherosclerosis
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
Disease
H00084  Graft-versus-host disease
H01492  Systemic sclerosis
Drug target
Pirfenidone: D01583
Rilonacept: D06635
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3552 (IL1A)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3552 (IL1A)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    3552 (IL1A)
   04218 Cellular senescence
    3552 (IL1A)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3552 (IL1A)
  Development
   04380 Osteoclast differentiation
    3552 (IL1A)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    3552 (IL1A)
   05321 Inflammatiory bowel disease (IBD)
    3552 (IL1A)
   05332 Graft-versus-host disease
    3552 (IL1A)
  Neurodegenerative diseases
   05020 Prion diseases
    3552 (IL1A)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3552 (IL1A)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3552 (IL1A)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3552 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3552 (IL1A)
  Infectious diseases
   05132 Salmonella infection
    3552 (IL1A)
   05133 Pertussis
    3552 (IL1A)
   05152 Tuberculosis
    3552 (IL1A)
   05162 Measles
    3552 (IL1A)
   05164 Influenza A
    3552 (IL1A)
   05140 Leishmaniasis
    3552 (IL1A)
Cytokines [BR:hsa04052]
 IL-1 family
  3552 (IL1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1_propep IL1
Motif
Other DBs
NCBI-GeneID: 3552
NCBI-ProteinID: NP_000566
OMIM: 147760
HGNC: 5991
Ensembl: ENSG00000115008
Vega: OTTHUMG00000131315
Pharos: P01583(Tchem)
UniProt: P01583
Structure
PDB: 

Jmol
Position
2q14.1
AA seq 271 aa AA seqDB search
MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS
NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI
TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP
NLFIATKQDYWVCLAGGPPSITDFQILENQA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagttccagacatgtttgaagacctgaagaactgttacagtgaaaatgaagaa
gacagttcctccattgatcatctgtctctgaatcagaaatccttctatcatgtaagctat
ggcccactccatgaaggctgcatggatcaatctgtgtctctgagtatctctgaaacctct
aaaacatccaagcttaccttcaaggagagcatggtggtagtagcaaccaacgggaaggtt
ctgaagaagagacggttgagtttaagccaatccatcactgatgatgacctggaggccatc
gccaatgactcagaggaagaaatcatcaagcctaggtcagcaccttttagcttcctgagc
aatgtgaaatacaactttatgaggatcatcaaatacgaattcatcctgaatgacgccctc
aatcaaagtataattcgagccaatgatcagtacctcacggctgctgcattacataatctg
gatgaagcagtgaaatttgacatgggtgcttataagtcatcaaaggatgatgctaaaatt
accgtgattctaagaatctcaaaaactcaattgtatgtgactgcccaagatgaagaccaa
ccagtgctgctgaaggagatgcctgagatacccaaaaccatcacaggtagtgagaccaac
ctcctcttcttctgggaaactcacggcactaagaactatttcacatcagttgcccatcca
aacttgtttattgccacaaagcaagactactgggtgtgcttggcaggggggccaccctct
atcactgactttcagatactggaaaaccaggcgtag

DBGET integrated database retrieval system