KEGG   Homo sapiens (human): 3554Help
Entry
3554              CDS       T01001                                 

Gene name
IL1R1, CD121A, D2S1473, IL-1R-alpha, IL1R, IL1RA, P80
Definition
interleukin 1 receptor, type I
Orthology
K04386  
interleukin 1 receptor type I
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Apoptosis
Osteoclast differentiation
Hematopoietic cell lineage
Inflammatory mediator regulation of TRP channels
Amoebiasis
HTLV-I infection
Drug target
Anakinra: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3554 (IL1R1)
   04064 NF-kappa B signaling pathway
    3554 (IL1R1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3554 (IL1R1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    3554 (IL1R1)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3554 (IL1R1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3554 (IL1R1)
  Development
   04380 Osteoclast differentiation
    3554 (IL1R1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    3554 (IL1R1)
   05146 Amoebiasis
    3554 (IL1R1)
Cellular antigens [BR:hsa04090]
 Proteins
  3554 (IL1R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q12
AA seq 569 aa AA seqDB search
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL
CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK
IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPSSKHQLLSPATKEKLQREAHVPLG
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgttactcagacttatttgtttcatagctctactgatttcttctctggaggct
gataaatgcaaggaacgtgaagaaaaaataattttagtgtcatctgcaaatgaaattgat
gttcgtccctgtcctcttaacccaaatgaacacaaaggcactataacttggtataaagat
gacagcaagacacctgtatctacagaacaagcctccaggattcatcaacacaaagagaaa
ctttggtttgttcctgctaaggtggaggattcaggacattactattgcgtggtaagaaat
tcatcttactgcctcagaattaaaataagtgcaaaatttgtggagaatgagcctaactta
tgttataatgcacaagccatatttaagcagaaactacccgttgcaggagacggaggactt
gtgtgcccttatatggagttttttaaaaatgaaaataatgagttacctaaattacagtgg
tataaggattgcaaacctctacttcttgacaatatacactttagtggagtcaaagatagg
ctcatcgtgatgaatgtggctgaaaagcatagagggaactatacttgtcatgcatcctac
acatacttgggcaagcaatatcctattacccgggtaatagaatttattactctagaggaa
aacaaacccacaaggcctgtgattgtgagcccagctaatgagacaatggaagtagacttg
ggatcccagatacaattgatctgtaatgtcaccggccagttgagtgacattgcttactgg
aagtggaatgggtcagtaattgatgaagatgacccagtgctaggggaagactattacagt
gtggaaaatcctgcaaacaaaagaaggagtaccctcatcacagtgcttaatatatcggaa
attgaaagtagattttataaacatccatttacctgttttgccaagaatacacatggtata
gatgcagcatatatccagttaatatatccagtcactaatttccagaagcacatgattggt
atatgtgtcacgttgacagtcataattgtgtgttctgttttcatctataaaatcttcaag
attgacattgtgctttggtacagggattcctgctatgattttctcccaataaaagcttca
gatggaaagacctatgacgcatatatactgtatccaaagactgttggggaagggtctacc
tctgactgtgatatttttgtgtttaaagtcttgcctgaggtcttggaaaaacagtgtgga
tataagctgttcatttatggaagggatgactacgttggggaagacattgttgaggtcatt
aatgaaaacgtaaagaaaagcagaagactgattatcattttagtcagagaaacatcaggc
ttcagctggctgggtggttcatctgaagagcaaatagccatgtataatgctcttgttcag
gatggaattaaagttgtcctgcttgagctggagaaaatccaagactatgagaaaatgcca
gaatcgattaaattcattaagcagaaacatggggctatccgctggtcaggggactttaca
cagggaccacagtctgcaaagacaaggttctggaagaatgtcaggtaccacatgccagtc
cagcgacggtcaccttcatctaaacaccagttactgtcaccagccactaaggagaaactg
caaagagaggctcacgtgcctctcgggtag

DBGET integrated database retrieval system