KEGG   Homo sapiens (human): 3558Help
Entry
3558              CDS       T01001                                 

Gene name
IL2, IL-2, TCGF, lymphokine
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05142  Chagas disease (American trypanosomiasis)
hsa05162  Measles
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease (IBD)
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00084  Graft-versus-host disease
H00408  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3558 (IL2)
   04151 PI3K-Akt signaling pathway
    3558 (IL2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3558 (IL2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    3558 (IL2)
   04660 T cell receptor signaling pathway
    3558 (IL2)
   04658 Th1 and Th2 cell differentiation
    3558 (IL2)
   04659 Th17 cell differentiation
    3558 (IL2)
   04672 Intestinal immune network for IgA production
    3558 (IL2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3558 (IL2)
  Immune diseases
   05320 Autoimmune thyroid disease
    3558 (IL2)
   05321 Inflammatiory bowel disease (IBD)
    3558 (IL2)
   05330 Allograft rejection
    3558 (IL2)
   05332 Graft-versus-host disease
    3558 (IL2)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3558 (IL2)
  Infectious diseases
   05166 HTLV-I infection
    3558 (IL2)
   05162 Measles
    3558 (IL2)
   05142 Chagas disease (American trypanosomiasis)
    3558 (IL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3558 (IL2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines (General comment) Chemotaxis, singal transduction, inflammation
   3558 (IL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL2 Plasmid_RAQPRD
Motif
Other DBs
NCBI-GeneID: 3558
NCBI-ProteinID: NP_000577
OMIM: 147680
HGNC: 6001
Ensembl: ENSG00000109471
Vega: OTTHUMG00000133075
Pharos: P60568(Tchem)
UniProt: P60568 Q0GK43
Structure
PDB: 

Jmol
Position
4q27
AA seq 153 aa AA seqDB search
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaactgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agacccagggacttaatcagcaatatcaacgtaatagttctggaactaaagggatctgaa
acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga
tggattaccttttgtcaaagcatcatctcaacactgacttga

DBGET integrated database retrieval system