KEGG   Homo sapiens (human): 3558Help
Entry
3558              CDS       T01001                                 

Gene name
IL2, IL-2, TCGF, lymphokine
Definition
interleukin 2
Orthology
K05429  
interleukin 2
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Chagas disease (American trypanosomiasis)
Measles
HTLV-I infection
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Allograft rejection
Graft-versus-host disease
Disease
H00084  
Graft-versus-host disease
H00408  
Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3558 (IL2)
   04151 PI3K-Akt signaling pathway
    3558 (IL2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3558 (IL2)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    3558 (IL2)
   04672 Intestinal immune network for IgA production
    3558 (IL2)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    3558 (IL2)
   05321 Inflammatiory bowel disease (IBD)
    3558 (IL2)
   05330 Allograft rejection
    3558 (IL2)
   05332 Graft-versus-host disease
    3558 (IL2)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3558 (IL2)
  Infectious diseases
   05166 HTLV-I infection
    3558 (IL2)
   05162 Measles
    3558 (IL2)
   05142 Chagas disease (American trypanosomiasis)
    3558 (IL2)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  3558 (IL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q26-q27
AA seq 153 aa AA seqDB search
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaactgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agacccagggacttaatcagcaatatcaacgtaatagttctggaactaaagggatctgaa
acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga
tggattaccttttgtcaaagcatcatctcaacactgacttga

DBGET integrated database retrieval system