KEGG   Homo sapiens (human): 356Help
Entry
356               CDS       T01001                                 

Gene name
FASLG, ALPS1B, APT1LG1, APTL, CD178, CD95-L, CD95L, FASL, TNFSF6
Definition
Fas ligand (TNF superfamily, member 6)
Orthology
K04389  
tumor necrosis factor ligand superfamily member 6
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Neurotrophin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Pathways in cancer
Proteoglycans in cancer
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Disease
H00108  
Autoimmune lymphoproliferative syndromes (ALPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    356 (FASLG)
   04010 MAPK signaling pathway
    356 (FASLG)
   04068 FoxO signaling pathway
    356 (FASLG)
   04151 PI3K-Akt signaling pathway
    356 (FASLG)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    356 (FASLG)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    356 (FASLG)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    356 (FASLG)
  Nervous system
   04722 Neurotrophin signaling pathway
    356 (FASLG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    356 (FASLG)
   05205 Proteoglycans in cancer
    356 (FASLG)
  Immune diseases
   05320 Autoimmune thyroid disease
    356 (FASLG)
   05330 Allograft rejection
    356 (FASLG)
   05332 Graft-versus-host disease
    356 (FASLG)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    356 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    356 (FASLG)
  Infectious diseases
   05162 Measles
    356 (FASLG)
   05164 Influenza A
    356 (FASLG)
   05161 Hepatitis B
    356 (FASLG)
   05168 Herpes simplex infection
    356 (FASLG)
   05142 Chagas disease (American trypanosomiasis)
    356 (FASLG)
   05143 African trypanosomiasis
    356 (FASLG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   356 (FASLG)
Cellular antigens [BR:hsa04090]
 Proteins
  356 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23
AA seq 281 aa AA seqDB search
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
PPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQ
MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGG
LVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWA
RSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccttcaattacccatatccccagatctactgggtggacagcagtgccagc
tctccctgggcccctccaggcacagttcttccctgtccaacctctgtgcccagaaggcct
ggtcaaaggaggccaccaccaccaccgccaccgccaccactaccacctccgccgccgccg
ccaccactgcctccactaccgctgccacccctgaagaagagagggaaccacagcacaggc
ctgtgtctccttgtgatgtttttcatggttctggttgccttggtaggattgggcctgggg
atgtttcagctcttccacctacagaaggagctggcagaactccgagagtctaccagccag
atgcacacagcatcatctttggagaagcaaataggccaccccagtccaccccctgaaaaa
aaggagctgaggaaagtggcccatttaacaggcaagtccaactcaaggtccatgcctctg
gaatgggaagacacctatggaattgtcctgctttctggagtgaagtataagaagggtggc
cttgtgatcaatgaaactgggctgtactttgtatattccaaagtatacttccggggtcaa
tcttgcaacaacctgcccctgagccacaaggtctacatgaggaactctaagtatccccag
gatctggtgatgatggaggggaagatgatgagctactgcactactgggcagatgtgggcc
cgcagcagctacctgggggcagtgttcaatcttaccagtgctgatcatttatatgtcaac
gtatctgagctctctctggtcaattttgaggaatctcagacgtttttcggcttatataag
ctctaa

DBGET integrated database retrieval system