KEGG   Homo sapiens (human): 3560Help
Entry
3560              CDS       T01001                                 

Gene name
IL2RB, CD122, IL15RB, P70-75
Definition
interleukin 2 receptor, beta
Orthology
K05069  
interleukin 2 receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Measles
HTLV-I infection
Transcriptional misregulation in cancer
Drug target
Denileukin diftitox: 
Aldesleukin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3560 (IL2RB)
   04151 PI3K-Akt signaling pathway
    3560 (IL2RB)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3560 (IL2RB)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3560 (IL2RB)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3560 (IL2RB)
  Infectious diseases
   05166 HTLV-I infection
    3560 (IL2RB)
   05162 Measles
    3560 (IL2RB)
Cellular antigens [BR:hsa04090]
 Proteins
  3560 (IL2RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 551 aa AA seqDB search
MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQ
VHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMA
IQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEE
APLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT
IPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV
QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFT
NQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT
FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVP
DLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQ
ELQGQDPTHLV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccctgctctgtcctggcgtctgcccctcctcatcctcctcctgcccctggct
acctcttgggcatctgcagcggtgaatggcacttcccagttcacatgcttctacaactcg
agagccaacatctcctgtgtctggagccaagatggggctctgcaggacacttcctgccaa
gtccatgcctggccggacagacggcggtggaaccaaacctgtgagctgctccccgtgagt
caagcatcctgggcctgcaacctgatcctcggagccccagattctcagaaactgaccaca
gttgacatcgtcaccctgagggtgctgtgccgtgagggggtgcgatggagggtgatggcc
atccaggacttcaagccctttgagaaccttcgcctgatggcccccatctccctccaagtt
gtccacgtggagacccacagatgcaacataagctgggaaatctcccaagcctcccactac
tttgaaagacacctggagttcgaggcccggacgctgtccccaggccacacctgggaggag
gcccccctgctgactctcaagcagaagcaggaatggatctgcctggagacgctcacccca
gacacccagtatgagtttcaggtgcgggtcaagcctctgcaaggcgagttcacgacctgg
agcccctggagccagcccctggccttcaggacaaagcctgcagcccttgggaaggacacc
attccgtggctcggccacctcctcgtgggcctcagcggggcttttggcttcatcatctta
gtgtacttgctgatcaactgcaggaacaccgggccatggctgaagaaggtcctgaagtgt
aacaccccagacccctcgaagttcttttcccagctgagctcagagcatggaggagacgtc
cagaagtggctctcttcgcccttcccctcatcgtccttcagccctggcggcctggcacct
gagatctcgccactagaagtgctggagagggacaaggtgacgcagctgctcctgcagcag
gacaaggtgcctgagcccgcatccttaagcagcaaccactcgctgaccagctgcttcacc
aaccagggttacttcttcttccacctcccggatgccttggagatagaggcctgccaggtg
tactttacttacgacccctactcagaggaagaccctgatgagggtgtggccggggcaccc
acagggtcttccccccaacccctgcagcctctgtcaggggaggacgacgcctactgcacc
ttcccctccagggatgacctgctgctcttctcccccagtctcctcggtggccccagcccc
ccaagcactgcccctgggggcagtggggccggtgaagagaggatgcccccttctttgcaa
gaaagagtccccagagactgggacccccagcccctggggcctcccaccccaggagtccca
gacctggtggattttcagccaccccctgagctggtgctgcgagaggctggggaggaggtc
cctgacgctggccccagggagggagtcagtttcccctggtccaggcctcctgggcagggg
gagttcagggcccttaatgctcgcctgcccctgaacactgatgcctacttgtccctccaa
gaactccagggtcaggacccaactcacttggtgtag

DBGET integrated database retrieval system