KEGG   Homo sapiens (human): 3560Help
Entry
3560              CDS       T01001                                 

Gene name
IL2RB, CD122, IL15RB, P70-75
Definition
interleukin 2 receptor, beta
Orthology
K05069  
interleukin 2 receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Measles
HTLV-I infection
Transcriptional misregulation in cancer
Drug target
Denileukin diftitox: 
Aldesleukin: 
Other: 
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 551 aa AA seqDB search
MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQ
VHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMA
IQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEE
APLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT
IPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV
QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFT
NQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT
FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVP
DLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQ
ELQGQDPTHLV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccctgctctgtcctggcgtctgcccctcctcatcctcctcctgcccctggct
acctcttgggcatctgcagcggtgaatggcacttcccagttcacatgcttctacaactcg
agagccaacatctcctgtgtctggagccaagatggggctctgcaggacacttcctgccaa
gtccatgcctggccggacagacggcggtggaaccaaacctgtgagctgctccccgtgagt
caagcatcctgggcctgcaacctgatcctcggagccccagattctcagaaactgaccaca
gttgacatcgtcaccctgagggtgctgtgccgtgagggggtgcgatggagggtgatggcc
atccaggacttcaagccctttgagaaccttcgcctgatggcccccatctccctccaagtt
gtccacgtggagacccacagatgcaacataagctgggaaatctcccaagcctcccactac
tttgaaagacacctggagttcgaggcccggacgctgtccccaggccacacctgggaggag
gcccccctgctgactctcaagcagaagcaggaatggatctgcctggagacgctcacccca
gacacccagtatgagtttcaggtgcgggtcaagcctctgcaaggcgagttcacgacctgg
agcccctggagccagcccctggccttcaggacaaagcctgcagcccttgggaaggacacc
attccgtggctcggccacctcctcgtgggcctcagcggggcttttggcttcatcatctta
gtgtacttgctgatcaactgcaggaacaccgggccatggctgaagaaggtcctgaagtgt
aacaccccagacccctcgaagttcttttcccagctgagctcagagcatggaggagacgtc
cagaagtggctctcttcgcccttcccctcatcgtccttcagccctggcggcctggcacct
gagatctcgccactagaagtgctggagagggacaaggtgacgcagctgctcctgcagcag
gacaaggtgcctgagcccgcatccttaagcagcaaccactcgctgaccagctgcttcacc
aaccagggttacttcttcttccacctcccggatgccttggagatagaggcctgccaggtg
tactttacttacgacccctactcagaggaagaccctgatgagggtgtggccggggcaccc
acagggtcttccccccaacccctgcagcctctgtcaggggaggacgacgcctactgcacc
ttcccctccagggatgacctgctgctcttctcccccagtctcctcggtggccccagcccc
ccaagcactgcccctgggggcagtggggccggtgaagagaggatgcccccttctttgcaa
gaaagagtccccagagactgggacccccagcccctggggcctcccaccccaggagtccca
gacctggtggattttcagccaccccctgagctggtgctgcgagaggctggggaggaggtc
cctgacgctggccccagggagggagtcagtttcccctggtccaggcctcctgggcagggg
gagttcagggcccttaatgctcgcctgcccctgaacactgatgcctacttgtccctccaa
gaactccagggtcaggacccaactcacttggtgtag

DBGET integrated database retrieval system