KEGG   Homo sapiens (human): 3561Help
Entry
3561              CDS       T01001                                 

Gene name
IL2RG, CD132, CIDX, IL-2RG, IMD4, P64, SCIDX, SCIDX1
Definition
interleukin 2 receptor, gamma
Orthology
K05070  
interleukin 2 receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Measles
HTLV-I infection
Inflammatory bowel disease (IBD)
Primary immunodeficiency
Disease
H00091  
T-B+Severe combined immunodeficiencies (SCIDs)
H00093  
Combined immunodeficiencies (CIDs)
Drug target
Denileukin diftitox: 
Aldesleukin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3561 (IL2RG)
   04151 PI3K-Akt signaling pathway
    3561 (IL2RG)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3561 (IL2RG)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3561 (IL2RG)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    3561 (IL2RG)
   05340 Primary immunodeficiency
    3561 (IL2RG)
  Infectious diseases
   05166 HTLV-I infection
    3561 (IL2RG)
   05162 Measles
    3561 (IL2RG)
Cellular antigens [BR:hsa04090]
 Proteins
  3561 (IL2RG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq13.1
AA seq 369 aa AA seqDB search
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAP
PCYTLKPET
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagccatcattaccattcacatccctcttattcctgcagctgcccctgctggga
gtggggctgaacacgacaattctgacgcccaatgggaatgaagacaccacagctgatttc
ttcctgaccactatgcccactgactccctcagtgtttccactctgcccctcccagaggtt
cagtgttttgtgttcaatgtcgagtacatgaattgcacttggaacagcagctctgagccc
cagcctaccaacctcactctgcattattggtacaagaactcggataatgataaagtccag
aagtgcagccactatctattctctgaagaaatcacttctggctgtcagttgcaaaaaaag
gagatccacctctaccaaacatttgttgttcagctccaggacccacgggaacccaggaga
caggccacacagatgctaaaactgcagaatctggtgatcccctgggctccagagaaccta
acacttcacaaactgagtgaatcccagctagaactgaactggaacaacagattcttgaac
cactgtttggagcacttggtgcagtaccggactgactgggaccacagctggactgaacaa
tcagtggattatagacataagttctccttgcctagtgtggatgggcagaaacgctacacg
tttcgtgttcggagccgctttaacccactctgtggaagtgctcagcattggagtgaatgg
agccacccaatccactgggggagcaatacttcaaaagagaatcctttcctgtttgcattg
gaagccgtggttatctctgttggctccatgggattgattatcagccttctctgtgtgtat
ttctggctggaacggacgatgccccgaattcccaccctgaagaacctagaggatcttgtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaagggactggctgagagt
ctgcagccagactacagtgaacgactctgcctcgtcagtgagattcccccaaaaggaggg
gcccttggggaggggcctggggcctccccatgcaaccagcatagcccctactgggccccc
ccatgttacaccctaaagcctgaaacctga

DBGET integrated database retrieval system