KEGG   Homo sapiens (human): 3562Help
Entry
3562              CDS       T01001                                 

Gene name
IL3, IL-3, MCGF, MULTI-CSF
Definition
interleukin 3
Orthology
K04736  
interleukin 3
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis
Jak-STAT signaling pathway
Hematopoietic cell lineage
Fc epsilon RI signaling pathway
Transcriptional misregulation in cancer
Asthma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3562 (IL3)
   04151 PI3K-Akt signaling pathway
    3562 (IL3)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3562 (IL3)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    3562 (IL3)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3562 (IL3)
   04664 Fc epsilon RI signaling pathway
    3562 (IL3)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3562 (IL3)
  Immune diseases
   05310 Asthma
    3562 (IL3)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  3562 (IL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 152 aa AA seqDB search
MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKD
GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcccgtcctgctcctgctccaactcctggtccgccccggactccaagct
cccatgacccagacaacgcccttgaagacaagctgggttaactgctctaacatgatcgat
gaaattataacacacttaaagcagccacctttgcctttgctggacttcaacaacctcaat
ggggaagaccaagacattctgatggaaaataaccttcgaaggccaaacctggaggcattc
aacagggctgtcaagagtttacagaacgcatcagcaattgagagcattcttaaaaatctc
ctgccatgtctgcccctggccacggccgcacccacgcgacatccaatccatatcaaggac
ggtgactggaatgaattccggaggaaactgacgttctatctgaaaacccttgagaatgcg
caggctcaacagacgactttgagcctcgcgatcttttga

DBGET integrated database retrieval system