KEGG   Homo sapiens (human): 3562Help
Entry
3562              CDS       T01001                                 

Gene name
IL3, IL-3, MCGF, MULTI-CSF
Definition
interleukin 3 (colony-stimulating factor, multiple)
Orthology
K04736  
interleukin 3
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis
Jak-STAT signaling pathway
Hematopoietic cell lineage
Fc epsilon RI signaling pathway
Transcriptional misregulation in cancer
Asthma
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Immune diseases; Asthma [PATH:hsa05310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 152 aa AA seqDB search
MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKD
GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcccgtcctgctcctgctccaactcctggtccgccccggactccaagct
cccatgacccagacaacgcccttgaagacaagctgggttaactgctctaacatgatcgat
gaaattataacacacttaaagcagccacctttgcctttgctggacttcaacaacctcaat
ggggaagaccaagacattctgatggaaaataaccttcgaaggccaaacctggaggcattc
aacagggctgtcaagagtttacagaacgcatcagcaattgagagcattcttaaaaatctc
ctgccatgtctgcccctggccacggccgcacccacgcgacatccaatccatatcaaggac
ggtgactggaatgaattccggaggaaactgacgttctatctgaaaacccttgagaatgcg
caggctcaacagacgactttgagcctcgcgatcttttga

DBGET integrated database retrieval system