KEGG   Homo sapiens (human): 3566Help
Entry
3566              CDS       T01001                                 

Gene name
IL4R, CD124, IL-4RA, IL4RA
Definition
interleukin 4 receptor
Orthology
K05071  
interleukin 4 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Inflammatory bowel disease (IBD)
Disease
H00079  
Asthma
H01358  
Atopic dermatitis
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p12.1-p11.2
AA seq 825 aa AA seqDB search
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRL
LYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEH
VKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYL
EPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSVS
CIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQDAQGSQWEKRSRGQEPAKCP
HWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVR
CVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGEENG
GFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPD
NLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPT
TVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGE
AGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPGCPGDPAPVPVPLFTFGLDRE
PPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVDSLGSGIVYSALTCHL
CGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLEASLCPASL
APSGISEKSKSSSSFHPAPGNAQSSSQTPKIVNFVSVGPTYMRVS
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggggtggctttgctctgggctcctgttccctgtgagctgcctggtcctgctgcaggtg
gcaagctctgggaacatgaaggtcttgcaggagcccacctgcgtctccgactacatgagc
atctctacttgcgagtggaagatgaatggtcccaccaattgcagcaccgagctccgcctg
ttgtaccagctggtttttctgctctccgaagcccacacgtgtatccctgagaacaacgga
ggcgcggggtgcgtgtgccacctgctcatggatgacgtggtcagtgcggataactataca
ctggacctgtgggctgggcagcagctgctgtggaagggctccttcaagcccagcgagcat
gtgaaacccagggccccaggaaacctgacagttcacaccaatgtctccgacactctgctg
ctgacctggagcaacccgtatccccctgacaattacctgtataatcatctcacctatgca
gtcaacatttggagtgaaaacgacccggcagatttcagaatctataacgtgacctaccta
gaaccctccctccgcatcgcagccagcaccctgaagtctgggatttcctacagggcacgg
gtgagggcctgggctcagtgctataacaccacctggagtgagtggagccccagcaccaag
tggcacaactcctacagggagcccttcgagcagcacctcctgctgggcgtcagcgtttcc
tgcattgtcatcctggccgtctgcctgttgtgctatgtcagcatcaccaagattaagaaa
gaatggtgggatcagattcccaacccagcccgcagccgcctcgtggctataataatccag
gatgctcaggggtcacagtgggagaagcggtcccgaggccaggaaccagccaagtgccca
cactggaagaattgtcttaccaagctcttgccctgttttctggagcacaacatgaaaagg
gatgaagatcctcacaaggctgccaaagagatgcctttccagggctctggaaaatcagca
tggtgcccagtggagatcagcaagacagtcctctggccagagagcatcagcgtggtgcga
tgtgtggagttgtttgaggccccggtggagtgtgaggaggaggaggaggtagaggaagaa
aaagggagcttctgtgcatcgcctgagagcagcagggatgacttccaggagggaagggag
ggcattgtggcccggctaacagagagcctgttcctggacctgctcggagaggagaatggg
ggcttttgccagcaggacatgggggagtcatgccttcttccaccttcgggaagtacgagt
gctcacatgccctgggatgagttcccaagtgcagggcccaaggaggcacctccctggggc
aaggagcagcctctccacctggagccaagtcctcctgccagcccgacccagagtccagac
aacctgacttgcacagagacgcccctcgtcatcgcaggcaaccctgcttaccgcagcttc
agcaactccctgagccagtcaccgtgtcccagagagctgggtccagacccactgctggcc
agacacctggaggaagtagaacccgagatgccctgtgtcccccagctctctgagccaacc
actgtgccccaacctgagccagaaacctgggagcagatcctccgccgaaatgtcctccag
catggggcagctgcagcccccgtctcggcccccaccagtggctatcaggagtttgtacat
gcggtggagcagggtggcacccaggccagtgcggtggtgggcttgggtcccccaggagag
gctggttacaaggccttctcaagcctgcttgccagcagtgctgtgtccccagagaaatgt
gggtttggggctagcagtggggaagaggggtataagcctttccaagacctcattcctggc
tgccctggggaccctgccccagtccctgtccccttgttcacctttggactggacagggag
ccacctcgcagtccgcagagctcacatctcccaagcagctccccagagcacctgggtctg
gagccgggggaaaaggtagaggacatgccaaagcccccacttccccaggagcaggccaca
gacccccttgtggacagcctgggcagtggcattgtctactcagcccttacctgccacctg
tgcggccacctgaaacagtgtcatggccaggaggatggtggccagacccctgtcatggcc
agtccttgctgtggctgctgctgtggagacaggtcctcgccccctacaacccccctgagg
gccccagacccctctccaggtggggttccactggaggccagtctgtgtccggcctccctg
gcaccctcgggcatctcagagaagagtaaatcctcatcatccttccatcctgcccctggc
aatgctcagagctcaagccagacccccaaaatcgtgaactttgtctccgtgggacccaca
tacatgagggtctcttag

DBGET integrated database retrieval system