KEGG   Homo sapiens (human): 3567Help
Entry
3567              CDS       T01001                                 

Gene name
IL5, EDF, IL-5, TRF
Definition
interleukin 5 (colony-stimulating factor, eosinophil)
Orthology
K05428  
interleukin 5
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Hematopoietic cell lineage
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Intestinal immune network for IgA production
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Allograft rejection
Drug target
Mepolizumab: 
Other: 
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Human Diseases; Immune diseases; Asthma [PATH:hsa05310]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Immune diseases; Allograft rejection [PATH:hsa05330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 134 aa AA seqDB search
MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH
QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ
EFLGVMNTEWIIES
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgcttctgcatttgagtttgctagctcttggagctgcctacgtgtatgccatc
cccacagaaattcccacaagtgcattggtgaaagagaccttggcactgctttctactcat
cgaactctgctgatagccaatgagactctgaggattcctgttcctgtacataaaaatcac
caactgtgcactgaagaaatctttcagggaataggcacactggagagtcaaactgtgcaa
gggggtactgtggaaagactattcaaaaacttgtccttaataaagaaatacattgacggc
caaaaaaaaaagtgtggagaagaaagacggagagtaaaccaattcctagactacctgcaa
gagtttcttggtgtaatgaacaccgagtggataatagaaagttga

DBGET integrated database retrieval system