KEGG   Homo sapiens (human): 3567Help
Entry
3567              CDS       T01001                                 

Gene name
IL5, EDF, IL-5, TRF
Definition
interleukin 5
Orthology
K05428  
interleukin 5
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Hematopoietic cell lineage
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Intestinal immune network for IgA production
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Allograft rejection
Drug target
Mepolizumab: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3567 (IL5)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3567 (IL5)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3567 (IL5)
   04660 T cell receptor signaling pathway
    3567 (IL5)
   04664 Fc epsilon RI signaling pathway
    3567 (IL5)
   04672 Intestinal immune network for IgA production
    3567 (IL5)
 Human Diseases
  Immune diseases
   05310 Asthma
    3567 (IL5)
   05320 Autoimmune thyroid disease
    3567 (IL5)
   05321 Inflammatiory bowel disease (IBD)
    3567 (IL5)
   05330 Allograft rejection
    3567 (IL5)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  3567 (IL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 134 aa AA seqDB search
MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH
QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ
EFLGVMNTEWIIES
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgcttctgcatttgagtttgctagctcttggagctgcctacgtgtatgccatc
cccacagaaattcccacaagtgcattggtgaaagagaccttggcactgctttctactcat
cgaactctgctgatagccaatgagactctgaggattcctgttcctgtacataaaaatcac
caactgtgcactgaagaaatctttcagggaataggcacactggagagtcaaactgtgcaa
gggggtactgtggaaagactattcaaaaacttgtccttaataaagaaatacattgacggc
caaaaaaaaaagtgtggagaagaaagacggagagtaaaccaattcctagactacctgcaa
gagtttcttggtgtaatgaacaccgagtggataatagaaagttga

DBGET integrated database retrieval system