KEGG   Homo sapiens (human): 3569Help
Entry
3569              CDS       T01001                                 

Gene name
IL6, BSF2, HGF, HSF, IFNB2, IL-6
Definition
interleukin 6 (interferon, beta 2)
Orthology
K05405  
interleukin 6
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
TNF signaling pathway
Intestinal immune network for IgA production
Non-alcoholic fatty liver disease (NAFLD)
Prion diseases
Salmonella infection
Pertussis
Legionellosis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Amoebiasis
Tuberculosis
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Pathways in cancer
Transcriptional misregulation in cancer
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Graft-versus-host disease
Hypertrophic cardiomyopathy (HCM)
Disease
H00084  
Graft-versus-host disease
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:hsa05332]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:hsa05020]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:hsa05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p21
AA seq 212 aa AA seqDB search
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaactccttctccacaagcgccttcggtccagttgccttctccctggggctgctcctg
gtgttgcctgctgccttccctgccccagtacccccaggagaagattccaaagatgtagcc
gccccacacagacagccactcacctcttcagaacgaattgacaaacaaattcggtacatc
ctcgacggcatctcagccctgagaaaggagacatgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctggtgaaaatcatcactggtcttttg
gagtttgaggtatacctagagtacctccagaacagatttgagagtagtgaggaacaagcc
agagctgtgcagatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat
ctagatgcaataaccacccctgacccaaccacaaatgccagcctgctgacgaagctgcag
gcacagaaccagtggctgcaggacatgacaactcatctcattctgcgcagctttaaggag
ttcctgcagtccagcctgagggctcttcggcaaatgtag

DBGET integrated database retrieval system