KEGG   Homo sapiens (human): 3570Help
Entry
3570              CDS       T01001                                 

Gene name
IL6R, CD126, IL-6R-1, IL-6RA, IL6Q, IL6RA, IL6RQ, gp80
Definition
interleukin 6 receptor
Orthology
K05055  
interleukin 6 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Non-alcoholic fatty liver disease (NAFLD)
Drug target
Tocilizumab: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3570 (IL6R)
   04066 HIF-1 signaling pathway
    3570 (IL6R)
   04151 PI3K-Akt signaling pathway
    3570 (IL6R)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3570 (IL6R)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3570 (IL6R)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3570 (IL6R)
Cellular antigens [BR:hsa04090]
 Proteins
  3570 (IL6R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 468 aa AA seqDB search
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS
SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgctggccgtcggctgcgcgctgctggctgccctgctggccgcgccgggagcggcgctg
gccccaaggcgctgccctgcgcaggaggtggcgagaggcgtgctgaccagtctgccagga
gacagcgtgactctgacctgcccgggggtagagccggaagacaatgccactgttcactgg
gtgctcaggaagccggctgcaggctcccaccccagcagatgggctggcatgggaaggagg
ctgctgctgaggtcggtgcagctccacgactctggaaactattcatgctaccgggccggc
cgcccagctgggactgtgcacttgctggtggatgttccccccgaggagccccagctctcc
tgcttccggaagagccccctcagcaatgttgtttgtgagtggggtcctcggagcacccca
tccctgacgacaaaggctgtgctcttggtgaggaagtttcagaacagtccggccgaagac
ttccaggagccgtgccagtattcccaggagtcccagaagttctcctgccagttagcagtc
ccggagggagacagctctttctacatagtgtccatgtgcgtcgccagtagtgtcgggagc
aagttcagcaaaactcaaacctttcagggttgtggaatcttgcagcctgatccgcctgcc
aacatcacagtcactgccgtggccagaaacccccgctggctcagtgtcacctggcaagac
ccccactcctggaactcatctttctacagactacggtttgagctcagatatcgggctgaa
cggtcaaagacattcacaacatggatggtcaaggacctccagcatcactgtgtcatccac
gacgcctggagcggcctgaggcacgtggtgcagcttcgtgcccaggaggagttcgggcaa
ggcgagtggagcgagtggagcccggaggccatgggcacgccttggacagaatccaggagt
cctccagctgagaacgaggtgtccacccccatgcaggcacttactactaataaagacgat
gataatattctcttcagagattctgcaaatgcgacaagcctcccagtgcaagattcttct
tcagtaccactgcccacattcctggttgctggagggagcctggccttcggaacgctcctc
tgcattgccattgttctgaggttcaagaagacgtggaagctgcgggctctgaaggaaggc
aagacaagcatgcatccgccgtactctttggggcagctggtcccggagaggcctcgaccc
accccagtgcttgttcctctcatctccccaccggtgtcccccagcagcctggggtctgac
aatacctcgagccacaaccgaccagatgccagggacccacggagcccttatgacatcagc
aatacagactacttcttccccagatag

DBGET integrated database retrieval system