KEGG   Homo sapiens (human): 3570Help
Entry
3570              CDS       T01001                                 

Gene name
IL6R, CD126, IL-6R-1, IL-6RA, IL6Q, IL6RA, IL6RQ, gp80
Definition
(RefSeq) interleukin 6 receptor
  KO
K05055  interleukin 6 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04060  Cytokine-cytokine receptor interaction
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04659  Th17 cell differentiation
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
Drug target
Sarilumab: D10161
Tocilizumab: D02596
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3570 (IL6R)
   04066 HIF-1 signaling pathway
    3570 (IL6R)
   04151 PI3K-Akt signaling pathway
    3570 (IL6R)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3570 (IL6R)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3570 (IL6R)
   04659 Th17 cell differentiation
    3570 (IL6R)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3570 (IL6R)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3570 (IL6R)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    3570 (IL6R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   3570 (IL6R)
CD molecules [BR:hsa04090]
 Proteins
  3570 (IL6R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind ig Ig_3 Ig_2 fn3 I-set Ig_5
Motif
Other DBs
NCBI-GeneID: 3570
NCBI-ProteinID: NP_000556
OMIM: 147880
HGNC: 6019
Ensembl: ENSG00000160712
Vega: OTTHUMG00000036073
Pharos: P08887(Tclin)
UniProt: P08887 A0N0L5
Structure
PDB: 

Jmol
Position
1q21.3
AA seq 468 aa AA seqDB search
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS
SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgctggccgtcggctgcgcgctgctggctgccctgctggccgcgccgggagcggcgctg
gccccaaggcgctgccctgcgcaggaggtggcgagaggcgtgctgaccagtctgccagga
gacagcgtgactctgacctgcccgggggtagagccggaagacaatgccactgttcactgg
gtgctcaggaagccggctgcaggctcccaccccagcagatgggctggcatgggaaggagg
ctgctgctgaggtcggtgcagctccacgactctggaaactattcatgctaccgggccggc
cgcccagctgggactgtgcacttgctggtggatgttccccccgaggagccccagctctcc
tgcttccggaagagccccctcagcaatgttgtttgtgagtggggtcctcggagcacccca
tccctgacgacaaaggctgtgctcttggtgaggaagtttcagaacagtccggccgaagac
ttccaggagccgtgccagtattcccaggagtcccagaagttctcctgccagttagcagtc
ccggagggagacagctctttctacatagtgtccatgtgcgtcgccagtagtgtcgggagc
aagttcagcaaaactcaaacctttcagggttgtggaatcttgcagcctgatccgcctgcc
aacatcacagtcactgccgtggccagaaacccccgctggctcagtgtcacctggcaagac
ccccactcctggaactcatctttctacagactacggtttgagctcagatatcgggctgaa
cggtcaaagacattcacaacatggatggtcaaggacctccagcatcactgtgtcatccac
gacgcctggagcggcctgaggcacgtggtgcagcttcgtgcccaggaggagttcgggcaa
ggcgagtggagcgagtggagcccggaggccatgggcacgccttggacagaatccaggagt
cctccagctgagaacgaggtgtccacccccatgcaggcacttactactaataaagacgat
gataatattctcttcagagattctgcaaatgcgacaagcctcccagtgcaagattcttct
tcagtaccactgcccacattcctggttgctggagggagcctggccttcggaacgctcctc
tgcattgccattgttctgaggttcaagaagacgtggaagctgcgggctctgaaggaaggc
aagacaagcatgcatccgccgtactctttggggcagctggtcccggagaggcctcgaccc
accccagtgcttgttcctctcatctccccaccggtgtcccccagcagcctggggtctgac
aatacctcgagccacaaccgaccagatgccagggacccacggagcccttatgacatcagc
aatacagactacttcttccccagatag

DBGET integrated database retrieval system