KEGG   Homo sapiens (human): 3575Help
Entry
3575              CDS       T01001                                 

Gene name
IL7R, CD127, CDW127, IL-7R-alpha, IL7RA, ILRA
Definition
interleukin 7 receptor
Orthology
K05072  
interleukin 7 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Primary immunodeficiency
Disease
H00091  
T-B+Severe combined immunodeficiencies (SCIDs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3575 (IL7R)
   04068 FoxO signaling pathway
    3575 (IL7R)
   04151 PI3K-Akt signaling pathway
    3575 (IL7R)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3575 (IL7R)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3575 (IL7R)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    3575 (IL7R)
Cellular antigens [BR:hsa04090]
 Proteins
  3575 (IL7R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p13
AA seq 459 aa AA seqDB search
MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKK
IDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTH
VNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP
ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
FGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgacaattctaggtacaacttttggcatggttttttctttacttcaagtcgtttctgga
gaaagtggctatgctcaaaatggagacttggaagatgcagaactggatgactactcattc
tcatgctatagccagttggaagtgaatggatcgcagcactcactgacctgtgcttttgag
gacccagatgtcaacatcaccaatctggaatttgaaatatgtggggccctcgtggaggta
aagtgcctgaatttcaggaaactacaagagatatatttcatcgagacaaagaaattctta
ctgattggaaagagcaatatatgtgtgaaggttggagaaaagagtctaacctgcaaaaaa
atagacctaaccactatagttaaacctgaggctccttttgacctgagtgtcgtctatcgg
gaaggagccaatgactttgtggtgacatttaatacatcacacttgcaaaagaagtatgta
aaagttttaatgcacgatgtagcttaccgccaggaaaaggatgaaaacaaatggacgcat
gtgaatttatccagcacaaagctgacactcctgcagagaaagctccaaccggcagcaatg
tatgagattaaagttcgatccatccctgatcactattttaaaggcttctggagtgaatgg
agtccaagttattacttcagaactccagagatcaataatagctcaggggagatggatcct
atcttactaaccatcagcattttgagttttttctctgtcgctctgttggtcatcttggcc
tgtgtgttatggaaaaaaaggattaagcctatcgtatggcccagtctccccgatcataag
aagactctggaacatctttgtaagaaaccaagaaaaaatttaaatgtgagtttcaatcct
gaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagtg
gaaggttttctgcaagatacgtttcctcagcaactagaagaatctgagaagcagaggctt
ggaggggatgtgcagagccccaactgcccatctgaggatgtagtcatcactccagaaagc
tttggaagagattcatccctcacatgcctggctgggaatgtcagtgcatgtgacgcccct
attctctcctcttccaggtccctagactgcagggagagtggcaagaatgggcctcatgtg
taccaggacctcctgcttagccttgggactacaaacagcacgctgccccctccattttct
ctccaatctggaatcctgacattgaacccagttgctcagggtcagcccattcttacttcc
ctgggatcaaatcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccagtga

DBGET integrated database retrieval system