KEGG   Homo sapiens (human): 3575Help
Entry
3575              CDS       T01001                                 

Gene name
IL7R, CD127, CDW127, IL-7R-alpha, IL7RA, ILRA
Definition
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
hsa05340  Primary immunodeficiency
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00091  T-B+Severe combined immunodeficiencies (SCIDs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3575 (IL7R)
   04068 FoxO signaling pathway
    3575 (IL7R)
   04151 PI3K-Akt signaling pathway
    3575 (IL7R)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3575 (IL7R)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3575 (IL7R)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3575 (IL7R)
  Immune diseases
   05340 Primary immunodeficiency
    3575 (IL7R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3575 (IL7R)
CD molecules [BR:hsa04090]
 Proteins
  3575 (IL7R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3
Motif
Other DBs
NCBI-GeneID: 3575
NCBI-ProteinID: NP_002176
OMIM: 146661
HGNC: 6024
Ensembl: ENSG00000168685
Vega: OTTHUMG00000090791
Pharos: P16871(Tbio)
UniProt: P16871
Structure
PDB: 

Jmol
Position
5p13.2
AA seq 459 aa AA seqDB search
MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKK
IDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTH
VNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP
ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
FGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgacaattctaggtacaacttttggcatggttttttctttacttcaagtcgtttctgga
gaaagtggctatgctcaaaatggagacttggaagatgcagaactggatgactactcattc
tcatgctatagccagttggaagtgaatggatcgcagcactcactgacctgtgcttttgag
gacccagatgtcaacatcaccaatctggaatttgaaatatgtggggccctcgtggaggta
aagtgcctgaatttcaggaaactacaagagatatatttcatcgagacaaagaaattctta
ctgattggaaagagcaatatatgtgtgaaggttggagaaaagagtctaacctgcaaaaaa
atagacctaaccactatagttaaacctgaggctccttttgacctgagtgtcgtctatcgg
gaaggagccaatgactttgtggtgacatttaatacatcacacttgcaaaagaagtatgta
aaagttttaatgcacgatgtagcttaccgccaggaaaaggatgaaaacaaatggacgcat
gtgaatttatccagcacaaagctgacactcctgcagagaaagctccaaccggcagcaatg
tatgagattaaagttcgatccatccctgatcactattttaaaggcttctggagtgaatgg
agtccaagttattacttcagaactccagagatcaataatagctcaggggagatggatcct
atcttactaaccatcagcattttgagttttttctctgtcgctctgttggtcatcttggcc
tgtgtgttatggaaaaaaaggattaagcctatcgtatggcccagtctccccgatcataag
aagactctggaacatctttgtaagaaaccaagaaaaaatttaaatgtgagtttcaatcct
gaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagtg
gaaggttttctgcaagatacgtttcctcagcaactagaagaatctgagaagcagaggctt
ggaggggatgtgcagagccccaactgcccatctgaggatgtagtcatcactccagaaagc
tttggaagagattcatccctcacatgcctggctgggaatgtcagtgcatgtgacgcccct
attctctcctcttccaggtccctagactgcagggagagtggcaagaatgggcctcatgtg
taccaggacctcctgcttagccttgggactacaaacagcacgctgccccctccattttct
ctccaatctggaatcctgacattgaacccagttgctcagggtcagcccattcttacttcc
ctgggatcaaatcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccagtga

DBGET integrated database retrieval system