KEGG   Homo sapiens (human): 3586Help
Entry
3586              CDS       T01001                                 

Gene name
IL10, CSIF, GVHDS, IL-10, IL10A, TGIF
Definition
interleukin 10
Orthology
K05443  
interleukin 10
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
Intestinal immune network for IgA production
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Staphylococcus aureus infection
Tuberculosis
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Allograft rejection
Disease
H00083  
Allograft rejection
H00084  
Graft-versus-host disease
H01359  
Anaphylaxis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3586 (IL10)
   04068 FoxO signaling pathway
    3586 (IL10)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3586 (IL10)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    3586 (IL10)
   04672 Intestinal immune network for IgA production
    3586 (IL10)
 Human Diseases
  Immune diseases
   05310 Asthma
    3586 (IL10)
   05322 Systemic lupus erythematosus
    3586 (IL10)
   05320 Autoimmune thyroid disease
    3586 (IL10)
   05321 Inflammatiory bowel disease (IBD)
    3586 (IL10)
   05330 Allograft rejection
    3586 (IL10)
  Infectious diseases
   05133 Pertussis
    3586 (IL10)
   05150 Staphylococcus aureus infection
    3586 (IL10)
   05152 Tuberculosis
    3586 (IL10)
   05169 Epstein-Barr virus infection
    3586 (IL10)
   05146 Amoebiasis
    3586 (IL10)
   05144 Malaria
    3586 (IL10)
   05145 Toxoplasmosis
    3586 (IL10)
   05140 Leishmaniasis
    3586 (IL10)
   05142 Chagas disease (American trypanosomiasis)
    3586 (IL10)
   05143 African trypanosomiasis
    3586 (IL10)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  3586 (IL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q31-q32
AA seq 178 aa AA seqDB search
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctcagcactgctctgttgcctggtcctcctgactggggtgagggccagccca
ggccagggcacccagtctgagaacagctgcacccacttcccaggcaacctgcctaacatg
cttcgagatctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag
ctggacaacttgttgttaaaggagtccttgctggaggactttaagggttacctgggttgc
caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac
caagacccagacatcaaggcgcatgtgaactccctgggggagaacctgaagaccctcagg
ctgaggctacggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggccgtggag
caggtgaagaatgcctttaataagctccaagagaaaggcatctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctacatgacaatgaagatacgaaactga

DBGET integrated database retrieval system