KEGG   Homo sapiens (human): 3592Help
Entry
3592              CDS       T01001                                 

Gene name
IL12A, CLMF, IL-12A, NFSK, NKSF1, P35
Definition
interleukin 12A
Orthology
K05406  
interleukin 12A
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Jak-STAT signaling pathway
Type I diabetes mellitus
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Inflammatory bowel disease (IBD)
Allograft rejection
Drug target
Ustekinumab: 
Briakinumab: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3592 (IL12A)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3592 (IL12A)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3592 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    3592 (IL12A)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    3592 (IL12A)
   05330 Allograft rejection
    3592 (IL12A)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3592 (IL12A)
  Infectious diseases
   05133 Pertussis
    3592 (IL12A)
   05134 Legionellosis
    3592 (IL12A)
   05152 Tuberculosis
    3592 (IL12A)
   05162 Measles
    3592 (IL12A)
   05164 Influenza A
    3592 (IL12A)
   05168 Herpes simplex infection
    3592 (IL12A)
   05146 Amoebiasis
    3592 (IL12A)
   05144 Malaria
    3592 (IL12A)
   05145 Toxoplasmosis
    3592 (IL12A)
   05140 Leishmaniasis
    3592 (IL12A)
   05142 Chagas disease (American trypanosomiasis)
    3592 (IL12A)
   05143 African trypanosomiasis
    3592 (IL12A)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  3592 (IL12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q25.33
AA seq 253 aa AA seqDB search
MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLLDHLSLARNLP
VATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACL
PLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLL
MDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRA
VTIDRVMSYLNAS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtggccccctgggtcagcctcccagccaccgccctcacctgccgcggccacaggtctg
catccagcggctcgccctgtgtccctgcagtgccggctcagcatgtgtccagcgcgcagc
ctcctccttgtggctaccctggtcctcctggaccacctcagtttggccagaaacctcccc
gtggccactccagacccaggaatgttcccatgccttcaccactcccaaaacctgctgagg
gccgtcagcaacatgctccagaaggccagacaaactctagaattttacccttgcacttct
gaagagattgatcatgaagatatcacaaaagataaaaccagcacagtggaggcctgttta
ccattggaattaaccaagaatgagagttgcctaaattccagagagacctctttcataact
aatgggagttgcctggcctccagaaagacctcttttatgatggccctgtgccttagtagt
atttatgaagacttgaagatgtaccaggtggagttcaagaccatgaatgcaaagcttctg
atggatcctaagaggcagatctttctagatcaaaacatgctggcagttattgatgagctg
atgcaggccctgaatttcaacagtgagactgtgccacaaaaatcctcccttgaagaaccg
gatttttataaaactaaaatcaagctctgcatacttcttcatgctttcagaattcgggca
gtgactattgatagagtgatgagctatctgaatgcttcctaa

DBGET integrated database retrieval system