KEGG   Homo sapiens (human): 3600Help
Entry
3600              CDS       T01001                                 

Gene name
IL15, IL-15
Definition
(RefSeq) interleukin 15
  KO
K05433  interleukin 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04668  TNF signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05166  HTLV-I infection
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
hsa05323  Rheumatoid arthritis
Network
N00053  Cytokine-Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3600 (IL15)
   04668 TNF signaling pathway
    3600 (IL15)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3600 (IL15)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    3600 (IL15)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3600 (IL15)
  Immune diseases
   05323 Rheumatoid arthritis
    3600 (IL15)
  Infectious diseases
   05166 HTLV-I infection
    3600 (IL15)
   05168 Herpes simplex infection
    3600 (IL15)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3600 (IL15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL15
Motif
Other DBs
NCBI-GeneID: 3600
NCBI-ProteinID: NP_000576
OMIM: 600554
HGNC: 5977
Ensembl: ENSG00000164136
Vega: OTTHUMG00000133418
Pharos: P40933(Tbio)
UniProt: P40933
Structure
PDB: 

Jmol
Position
4q31.21
AA seq 162 aa AA seqDB search
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANN
SLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagaatttcgaaaccacatttgagaagtatttccatccagtgctacttgtgtttactt
ctaaacagtcattttctaactgaagctggcattcatgtcttcattttgggctgtttcagt
gcagggcttcctaaaacagaagccaactgggtgaatgtaataagtgatttgaaaaaaatt
gaagatcttattcaatctatgcatattgatgctactttatatacggaaagtgatgttcac
cccagttgcaaagtaacagcaatgaagtgctttctcttggagttacaagttatttcactt
gagtccggagatgcaagtattcatgatacagtagaaaatctgatcatcctagcaaacaac
agtttgtcttctaatgggaatgtaacagaatctggatgcaaagaatgtgaggaactggag
gaaaaaaatattaaagaatttttgcagagttttgtacatattgtccaaatgttcatcaac
acttcttga

DBGET integrated database retrieval system