KEGG   Homo sapiens (human): 3600Help
Entry
3600              CDS       T01001                                 

Gene name
IL15, IL-15
Definition
interleukin 15
Orthology
K05433  
interleukin 15
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
TNF signaling pathway
Intestinal immune network for IgA production
HTLV-I infection
Herpes simplex infection
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3600 (IL15)
   04668 TNF signaling pathway
    3600 (IL15)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3600 (IL15)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    3600 (IL15)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    3600 (IL15)
  Infectious diseases
   05166 HTLV-I infection
    3600 (IL15)
   05168 Herpes simplex infection
    3600 (IL15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q31
AA seq 162 aa AA seqDB search
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANN
SLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagaatttcgaaaccacatttgagaagtatttccatccagtgctacttgtgtttactt
ctaaacagtcattttctaactgaagctggcattcatgtcttcattttgggctgtttcagt
gcagggcttcctaaaacagaagccaactgggtgaatgtaataagtgatttgaaaaaaatt
gaagatcttattcaatctatgcatattgatgctactttatatacggaaagtgatgttcac
cccagttgcaaagtaacagcaatgaagtgctttctcttggagttacaagttatttcactt
gagtccggagatgcaagtattcatgatacagtagaaaatctgatcatcctagcaaacaac
agtttgtcttctaatgggaatgtaacagaatctggatgcaaagaatgtgaggaactggag
gaaaaaaatattaaagaatttttgcagagttttgtacatattgtccaaatgttcatcaac
acttcttga

DBGET integrated database retrieval system