KEGG   Homo sapiens (human): 3612Help
Entry
3612              CDS       T01001                                 

Gene name
IMPA1, IMP, IMPA
Definition
(RefSeq) inositol monophosphatase 1 (EC:3.1.3.25 3.1.3.94)
  KO
K01092  
myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3612 (IMPA1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    3612 (IMPA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     3612 (IMPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q21.13-q21.3
AA seq 277 aa AA seqDB search
MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKE
KYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFG
VVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNME
KLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTG
GPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggctgatccttggcaggaatgcatggattatgcagtaactctagcaagacaagctgga
gaggtagtttgtgaagctataaaaaatgaaatgaatgttatgctgaaaagttctccagtt
gatttggtaactgctacggaccaaaaagttgaaaaaatgcttatctcttccataaaggaa
aagtatccatctcacagtttcattggtgaagaatctgtggcagctggggaaaaaagtatc
ttaaccgacaaccccacatggatcattgaccctattgatggaacaactaactttgtacat
agatttccttttgtagctgtttcaattggctttgctgtaaataaaaagatagaatttgga
gttgtgtacagttgtgtggaaggcaagatgtacactgccagaaaaggaaaaggtgccttt
tgtaatggtcaaaaactacaagtttcacaacaagaagatattaccaaatctctcttggtg
actgagttgggctcttccagaacaccagagactgtgagaatggttctttctaatatggaa
aagcttttttgcattcctgttcatgggatccggagtgttggaacagcagctgttaatatg
tgccttgtggcaactggcggagcagatgcatattatgaaatgggaattcactgctgggat
gttgcaggagctggcattattgttactgaagctggtggcgtgctaatggatgttacaggt
ggaccatttgatttgatgtcacgaagagtaattgctgcaaataatagaatattagcagaa
aggatagctaaagaaattcaggttatacctttgcaacgagacgacgaagattaa

DBGET integrated database retrieval system