KEGG   Homo sapiens (human): 3613Help
Entry
3613              CDS       T01001                                 

Gene name
IMPA2
Definition
(RefSeq) inositol monophosphatase 2
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3613 (IMPA2)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    3613 (IMPA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     3613 (IMPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 3613
NCBI-ProteinID: NP_055029
OMIM: 605922
HGNC: 6051
Ensembl: ENSG00000141401
Vega: OTTHUMG00000131693
Pharos: O14732(Tbio)
UniProt: O14732
Structure
PDB: 

Jmol
Position
18p11.21
AA seq 288 aa AA seqDB search
MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHL
VEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSI
GFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDP
ATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIR
EAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgagcggcgaggaccaggcggcgctggcggccggcccctgggaggagtgcttc
caggcggccgtgcagctggcgctgcgggcaggacagatcatcagaaaagcccttactgag
gaaaaacgtgtctcaacaaaaacatcagctgcagatcttgtgacagaaacagatcacctt
gtggaagatttaattatttctgagttgcgagagaggtttccttcacacaggttcattgca
gaagaggccgcggcttctggggccaagtgtgtgctcacccacagcccgacgtggatcatc
gaccccatcgacggcacctgcaattttgtgcacagattcccgactgtggcggttagcatt
ggatttgctgttcgacaagagcttgaattcggagtgatttaccactgcacagaggagcgg
ctgtacacgggccggcggggtcggggcgccttctgcaatggccagcggctccgggtctcc
ggggagacagatctctcaaaggccttggttctgacagaaattggccccaaacgtgaccct
gcgaccctgaagctgttcctgagtaacatggagcggctgctgcatgccaaggcgcatggg
gtccgagtgattggaagctccacattggcactctgccacctggcctcaggggccgcggat
gcctattaccagtttggcctgcactgctgggatctggcggctgccacagtcatcatcaga
gaagcaggcggcatcgtgatagacacttcgggtggacccctcgacctcatggcttgcaga
gtggttgcggccagcacccgggagatggcgatgctcatagctcaggccttacagacgatt
aactatgggcgggatgatgagaagtga

DBGET integrated database retrieval system