KEGG   Homo sapiens (human): 3615Help
Entry
3615              CDS       T01001                                 

Gene name
IMPDH2, IMPD2, IMPDH-II
Definition
IMP (inosine 5'-monophosphate) dehydrogenase 2 (EC:1.1.1.205)
Orthology
K00088  
IMP dehydrogenase [EC:1.1.1.205]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Drug target
Mycophenolic acid: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    3615 (IMPDH2)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    3615 (IMPDH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     3615 (IMPDH2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3615 (IMPDH2)
  Exosomal proteins of breast cancer cells
   3615 (IMPDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.2
AA seq 514 aa AA seqDB search
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggccgactacctgattagtgggggcacgtcctacgtgccagacgacggactcacagca
cagcagctcttcaactgcggagacggcctcacctacaatgactttctcattctccctggg
tacatcgacttcactgcagaccaggtggacctgacttctgctctgaccaagaaaatcact
cttaagaccccactggtttcctctcccatggacacagtcacagaggctgggatggccata
gcaatggcgcttacaggcggtattggcttcatccaccacaactgtacacctgaattccag
gccaatgaagttcggaaagtgaagaaatatgaacagggattcatcacagaccctgtggtc
ctcagccccaaggatcgcgtgcgggatgtttttgaggccaaggcccggcatggtttctgc
ggtatcccaatcacagacacaggccggatggggagccgcttggtgggcatcatctcctcc
agggacattgattttctcaaagaggaggaacatgactgtttcttggaagagataatgaca
aagagggaagacttggtggtagcccctgcaggcatcacactgaaggaggcaaatgaaatt
ctgcagcgcagcaagaagggaaagttgcccattgtaaatgaagatgatgagcttgtggcc
atcattgcccggacagacctgaagaagaatcgggactacccactagcctccaaagatgcc
aagaaacagctgctgtgtggggcagccattggcactcatgaggatgacaagtataggctg
gacttgctcgcccaggctggtgtggatgtagtggttttggactcttcccagggaaattcc
atcttccagatcaatatgatcaagtacatcaaagacaaataccctaatctccaagtcatt
ggaggcaatgtggtcactgctgcccaggccaagaacctcattgatgcaggtgtggatgcc
ctgcgggtgggcatgggaagtggctccatctgcattacgcaggaagtgctggcctgtggg
cggccccaagcaacagcagtgtacaaggtgtcagagtatgcacggcgctttggtgttccg
gtcattgctgatggaggaatccaaaatgtgggtcatattgcgaaagccttggcccttggg
gcctccacagtcatgatgggctctctcctggctgccaccactgaggcccctggtgaatac
ttcttttccgatgggatccggctaaagaaatatcgcggtatgggttctctcgatgccatg
gacaagcacctcagcagccagaacagatatttcagtgaagctgacaaaatcaaagtggcc
cagggagtgtctggtgctgtgcaggacaaagggtcaatccacaaatttgtcccttacctg
attgctggcatccaacactcatgccaggacattggtgccaagagcttgacccaagtccga
gccatgatgtactctggggagcttaagtttgagaagagaacgtcctcagcccaggtggaa
ggtggcgtccatagcctccattcgtatgagaagcggcttttctga

DBGET integrated database retrieval system