KEGG   Homo sapiens (human): 3615Help
Entry
3615              CDS       T01001                                 

Gene name
IMPDH2, IMPD2, IMPDH-II
Definition
(RefSeq) inosine monophosphate dehydrogenase 2
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Module
hsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Drug target
Merimepodib: D04936
Mizoribine: D01392
Mycophenolic acid (DG00739): D00752 D05094 D05095 D05096
Tiazofurine: D06130
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    3615 (IMPDH2)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    3615 (IMPDH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     3615 (IMPDH2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3615 (IMPDH2)
  Exosomal proteins of breast cancer cells
   3615 (IMPDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMPDH NMO CBS FMN_dh His_biosynth NanE ThiG Dus Glu_synthase DUF561
Motif
Other DBs
NCBI-GeneID: 3615
NCBI-ProteinID: NP_000875
OMIM: 146691
HGNC: 6053
Ensembl: ENSG00000178035
Vega: OTTHUMG00000156771
Pharos: P12268(Tclin)
UniProt: P12268
Structure
PDB: 

Jmol
Position
3p21.31
AA seq 514 aa AA seqDB search
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggccgactacctgattagtgggggcacgtcctacgtgccagacgacggactcacagca
cagcagctcttcaactgcggagacggcctcacctacaatgactttctcattctccctggg
tacatcgacttcactgcagaccaggtggacctgacttctgctctgaccaagaaaatcact
cttaagaccccactggtttcctctcccatggacacagtcacagaggctgggatggccata
gcaatggcgcttacaggcggtattggcttcatccaccacaactgtacacctgaattccag
gccaatgaagttcggaaagtgaagaaatatgaacagggattcatcacagaccctgtggtc
ctcagccccaaggatcgcgtgcgggatgtttttgaggccaaggcccggcatggtttctgc
ggtatcccaatcacagacacaggccggatggggagccgcttggtgggcatcatctcctcc
agggacattgattttctcaaagaggaggaacatgactgtttcttggaagagataatgaca
aagagggaagacttggtggtagcccctgcaggcatcacactgaaggaggcaaatgaaatt
ctgcagcgcagcaagaagggaaagttgcccattgtaaatgaagatgatgagcttgtggcc
atcattgcccggacagacctgaagaagaatcgggactacccactagcctccaaagatgcc
aagaaacagctgctgtgtggggcagccattggcactcatgaggatgacaagtataggctg
gacttgctcgcccaggctggtgtggatgtagtggttttggactcttcccagggaaattcc
atcttccagatcaatatgatcaagtacatcaaagacaaataccctaatctccaagtcatt
ggaggcaatgtggtcactgctgcccaggccaagaacctcattgatgcaggtgtggatgcc
ctgcgggtgggcatgggaagtggctccatctgcattacgcaggaagtgctggcctgtggg
cggccccaagcaacagcagtgtacaaggtgtcagagtatgcacggcgctttggtgttccg
gtcattgctgatggaggaatccaaaatgtgggtcatattgcgaaagccttggcccttggg
gcctccacagtcatgatgggctctctcctggctgccaccactgaggcccctggtgaatac
ttcttttccgatgggatccggctaaagaaatatcgcggtatgggttctctcgatgccatg
gacaagcacctcagcagccagaacagatatttcagtgaagctgacaaaatcaaagtggcc
cagggagtgtctggtgctgtgcaggacaaagggtcaatccacaaatttgtcccttacctg
attgctggcatccaacactcatgccaggacattggtgccaagagcttgacccaagtccga
gccatgatgtactctggggagcttaagtttgagaagagaacgtcctcagcccaggtggaa
ggtggcgtccatagcctccattcgtatgagaagcggcttttctga

DBGET integrated database retrieval system