KEGG   Homo sapiens (human): 3624Help
Entry
3624              CDS       T01001                                 

Gene name
INHBA, EDF, FRP
Definition
inhibin, beta A
Orthology
K04667  
inhibin, beta
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    3624 (INHBA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3624 (INHBA)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    3624 (INHBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p15-p13
AA seq 426 aa AA seqDB search
MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKK
HILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQT
SEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQK
HPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDV
RIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQS
EDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAG
TSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV
EECGCS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgctttggctgagaggatttctgttggcaagttgctggattatagtgaggagt
tcccccaccccaggatccgaggggcacagcgcggcccccgactgtccgtcctgtgcgctg
gccgccctcccaaaggatgtacccaactctcagccagagatggtggaggccgtcaagaag
cacattttaaacatgctgcacttgaagaagagacccgatgtcacccagccggtacccaag
gcggcgcttctgaacgcgatcagaaagcttcatgtgggcaaagtcggggagaacgggtat
gtggagatagaggatgacattggaaggagggcagaaatgaatgaacttatggagcagacc
tcggagatcatcacgtttgccgagtcaggaacagccaggaagacgctgcacttcgagatt
tccaaggaaggcagtgacctgtcagtggtggagcgtgcagaagtctggctcttcctaaaa
gtccccaaggccaacaggaccaggaccaaagtcaccatccgcctcttccagcagcagaag
cacccgcagggcagcttggacacaggggaagaggccgaggaagtgggcttaaagggggag
aggagtgaactgttgctctctgaaaaagtagtagacgctcggaagagcacctggcatgtc
ttccctgtctccagcagcatccagcggttgctggaccagggcaagagctccctggacgtt
cggattgcctgtgagcagtgccaggagagtggcgccagcttggttctcctgggcaagaag
aagaagaaagaagaggagggggaagggaaaaagaagggcggaggtgaaggtggggcagga
gcagatgaggaaaaggagcagtcgcacagacctttcctcatgctgcaggcccggcagtct
gaagaccaccctcatcgccggcgtcggcggggcttggagtgtgatggcaaggtcaacatc
tgctgtaagaaacagttctttgtcagtttcaaggacatcggctggaatgactggatcatt
gctccctctggctatcatgccaactactgcgagggtgagtgcccgagccatatagcaggc
acgtccgggtcctcactgtccttccactcaacagtcatcaaccactaccgcatgcggggc
catagcccctttgccaacctcaaatcgtgctgtgtgcccaccaagctgagacccatgtcc
atgttgtactatgatgatggtcaaaacatcatcaaaaaggacattcagaacatgatcgtg
gaggagtgtgggtgctcatag

DBGET integrated database retrieval system