KEGG   Homo sapiens (human): 3627Help
Entry
3627              CDS       T01001                                 

Gene name
CXCL10, C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1
Definition
chemokine (C-X-C motif) ligand 10
Orthology
K12671  
C-X-C motif chemokine 10
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
TNF signaling pathway
Influenza A
Disease
H01360  
Allergic rhinitis
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    3627 (CXCL10)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3627 (CXCL10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3627 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    3627 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    3627 (CXCL10)
   04062 Chemokine signaling pathway
    3627 (CXCL10)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    3627 (CXCL10)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
  3627 (CXCL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q21
AA seq 98 aa AA seqDB search
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV
EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaactgccattctgatttgctgccttatctttctgactctaagtggcattcaa
ggagtacctctctctagaactgtacgctgtacctgcatcagcattagtaatcaacctgtt
aatccaaggtctttagaaaaacttgaaattattcctgcaagccaattttgtccacgtgtt
gagatcattgctacaatgaaaaagaagggtgagaagagatgtctgaatccagaatcgaag
gccatcaagaatttactgaaagcagttagcaaggaaaggtctaaaagatctccttaa

DBGET integrated database retrieval system