KEGG   Homo sapiens (human): 3630Help
Entry
3630              CDS       T01001                                 

Gene name
INS, IDDM1, IDDM2, ILPR, IRDN, MODY10
Definition
insulin
Orthology
K04526  
insulin
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Oocyte meiosis
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Insulin secretion
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Maturity onset diabetes of the young
Aldosterone-regulated sodium reabsorption
Prostate cancer
Disease
H00408  
Type I diabetes mellitus
H00410  
Maturity onset diabetes of the young (MODY)
H00512  
Permanent neonatal diabetes mellitus (PNDM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3630 (INS)
   04015 Rap1 signaling pathway
    3630 (INS)
   04066 HIF-1 signaling pathway
    3630 (INS)
   04068 FoxO signaling pathway
    3630 (INS)
   04022 cGMP - PKG signaling pathway
    3630 (INS)
   04151 PI3K-Akt signaling pathway
    3630 (INS)
   04152 AMPK signaling pathway
    3630 (INS)
   04150 mTOR signaling pathway
    3630 (INS)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    3630 (INS)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3630 (INS)
  Cell growth and death
   04114 Oocyte meiosis
    3630 (INS)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    3630 (INS)
   04910 Insulin signaling pathway
    3630 (INS)
   04913 Ovarian Steroidogenesis
    3630 (INS)
   04914 Progesterone-mediated oocyte maturation
    3630 (INS)
   04917 Prolactin signaling pathway
    3630 (INS)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3630 (INS)
 Human Diseases
  Cancers
   05215 Prostate cancer
    3630 (INS)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3630 (INS)
   04930 Type II diabetes mellitus
    3630 (INS)
   04950 Maturity onset diabetes of the young
    3630 (INS)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3630 (INS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 110 aa AA seqDB search
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtggatgcgcctcctgcccctgctggcgctgctggccctctggggacctgac
ccagccgcagcctttgtgaaccaacacctgtgcggctcacacctggtggaagctctctac
ctagtgtgcggggaacgaggcttcttctacacacccaagacccgccgggaggcagaggac
ctgcaggtggggcaggtggagctgggcgggggccctggtgcaggcagcctgcagcccttg
gccctggaggggtccctgcagaagcgtggcattgtggaacaatgctgtaccagcatctgc
tccctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system