KEGG   Homo sapiens (human): 3643Help
Entry
3643              CDS       T01001                                 

Gene name
INSR, CD220, HHF5
Definition
insulin receptor (EC:2.7.10.1)
Orthology
K04527  
insulin receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Adherens junction
Insulin signaling pathway
Ovarian steroidogenesis
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
Disease
H00719  
Leprechaunism
H00942  
Rabson-Mendenhall syndrome
H01228  
Insulin-resistant diabetes mellitus with acanthosis nigricans (IRAN)
H01267  
Familial hyperinsulinemic hypoglycemia (HHF)
Drug target
Insulin (human): 
Insulin (pork): 
Insulin lispro: 
Insulin aspart: 
Insulin glulisine: 
Insulin glargine: 
Insulin detemir: 
Insulin degludec: 
Other: 
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:hsa04913]
Organismal Systems; Excretory system; Aldosterone-regulated sodium reabsorption [PATH:hsa04960]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3-p13.2
AA seq 1382 aa AA seqDB search
MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAF
PNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCV
SRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSR
EKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSN
PS
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgggggccggcggggggcggcggccgcgccgctgctggtggcggtggccgcg
ctgctactgggcgccgcgggccacctgtaccccggagaggtgtgtcccggcatggatatc
cggaacaacctcactaggttgcatgagctggagaattgctctgtcatcgaaggacacttg
cagatactcttgatgttcaaaacgaggcccgaagatttccgagacctcagtttccccaaa
ctcatcatgatcactgattacttgctgctcttccgggtctatgggctcgagagcctgaag
gacctgttccccaacctcacggtcatccggggatcacgactgttctttaactacgcgctg
gtcatcttcgagatggttcacctcaaggaactcggcctctacaacctgatgaacatcacc
cggggttctgtccgcatcgagaagaacaatgagctctgttacttggccactatcgactgg
tcccgtatcctggattccgtggaggataattacatcgtgttgaacaaagatgacaacgag
gagtgtggagacatctgtccgggtaccgcgaagggcaagaccaactgccccgccaccgtc
atcaacgggcagtttgtcgaacgatgttggactcatagtcactgccagaaagtttgcccg
accatctgtaagtcacacggctgcaccgccgaaggcctctgttgccacagcgagtgcctg
ggcaactgttctcagcccgacgaccccaccaagtgcgtggcctgccgcaacttctacctg
gacggcaggtgtgtggagacctgcccgcccccgtactaccacttccaggactggcgctgt
gtgaacttcagcttctgccaggacctgcaccacaaatgcaagaactcgcggaggcagggc
tgccaccagtacgtcattcacaacaacaagtgcatccctgagtgtccctccgggtacacg
atgaattccagcaacttgctgtgcaccccatgcctgggtccctgtcccaaggtgtgccac
ctcctagaaggcgagaagaccatcgactcggtgacgtctgcccaggagctccgaggatgc
accgtcatcaacgggagtctgatcatcaacattcgaggaggcaacaatctggcagctgag
ctagaagccaacctcggcctcattgaagaaatttcagggtatctaaaaatccgccgatcc
tacgctctggtgtcactttccttcttccggaagttacgtctgattcgaggagagaccttg
gaaattgggaactactccttctatgccttggacaaccagaacctaaggcagctctgggac
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccactataaccccaaa
ctctgcttgtcagaaatccacaagatggaagaagtttcaggaaccaaggggcgccaggag
agaaacgacattgccctgaagaccaatggggaccaggcatcctgtgaaaatgagttactt
aaattttcttacattcggacatcttttgacaagatcttgctgagatgggagccgtactgg
ccccccgacttccgagacctcttggggttcatgctgttctacaaagaggccccttatcag
aatgtgacggagttcgacgggcaggatgcgtgtggttccaacagttggacggtggtagac
attgacccacccctgaggtccaacgaccccaaatcacagaaccacccagggtggctgatg
cggggtctcaagccctggacccagtatgccatctttgtgaagaccctggtcaccttttcg
gatgaacgccggacctatggggccaagagtgacatcatttatgtccagacagatgccacc
aacccctctgtgcccctggatccaatctcagtgtctaactcatcatcccagattattctg
aagtggaaaccaccctccgaccccaatggcaacatcacccactacctggttttctgggag
aggcaggcggaagacagtgagctgttcgagctggattattgcctcaaagggctgaagctg
ccctcgaggacctggtctccaccattcgagtctgaagattctcagaagcacaaccagagt
gagtatgaggattcggccggcgaatgctgctcctgtccaaagacagactctcagatcctg
aaggagctggaggagtcctcgtttaggaagacgtttgaggattacctgcacaacgtggtt
ttcgtccccagaaaaacctcttcaggcactggtgccgaggaccctaggccatctcggaaa
cgcaggtcccttggcgatgttgggaatgtgacggtggccgtgcccacggtggcagctttc
cccaacacttcctcgaccagcgtgcccacgagtccggaggagcacaggccttttgagaag
gtggtgaacaaggagtcgctggtcatctccggcttgcgacacttcacgggctatcgcatc
gagctgcaggcttgcaaccaggacacccctgaggaacggtgcagtgtggcagcctacgtc
agtgcgaggaccatgcctgaagccaaggctgatgacattgttggccctgtgacgcatgaa
atctttgagaacaacgtcgtccacttgatgtggcaggagccgaaggagcccaatggtctg
atcgtgctgtatgaagtgagttatcggcgatatggtgatgaggagctgcatctctgcgtc
tcccgcaagcacttcgctctggaacggggctgcaggctgcgtgggctgtcaccggggaac
tacagcgtgcgaatccgggccacctcccttgcgggcaacggctcttggacggaacccacc
tatttctacgtgacagactatttagacgtcccgtcaaatattgcaaaaattatcatcggc
cccctcatctttgtctttctcttcagtgttgtgattggaagtatttatctattcctgaga
aagaggcagccagatgggccgctgggaccgctttacgcttcttcaaaccctgagtatctc
agtgccagtgatgtgtttccatgctctgtgtacgtgccggacgagtgggaggtgtctcga
gagaagatcaccctccttcgagagctggggcagggctccttcggcatggtgtatgagggc
aatgccagggacatcatcaagggtgaggcagagacccgcgtggcggtgaagacggtcaac
gagtcagccagtctccgagagcggattgagttcctcaatgaggcctcggtcatgaagggc
ttcacctgccatcacgtggtgcgcctcctgggagtggtgtccaagggccagcccacgctg
gtggtgatggagctgatggctcacggagacctgaagagctacctccgttctctgcggcca
gaggctgagaataatcctggccgccctccccctacccttcaagagatgattcagatggcg
gcagagattgctgacgggatggcctacctgaacgccaagaagtttgtgcatcgggacctg
gcagcgagaaactgcatggtcgcccatgattttactgtcaaaattggagactttggaatg
accagagacatctatgaaacggattactaccggaaagggggcaagggtctgctccctgta
cggtggatggcaccggagtccctgaaggatggggtcttcaccacttcttctgacatgtgg
tcctttggcgtggtcctttgggaaatcaccagcttggcagaacagccttaccaaggcctg
tctaatgaacaggtgttgaaatttgtcatggatggagggtatctggatcaacccgacaac
tgtccagagagagtcactgacctcatgcgcatgtgctggcaattcaaccccaagatgagg
ccaaccttcctggagattgtcaacctgctcaaggacgacctgcaccccagctttccagag
gtgtcgttcttccacagcgaggagaacaaggctcccgagagtgaggagctggagatggag
tttgaggacatggagaatgtgcccctggaccgttcctcgcactgtcagagggaggaggcg
gggggccgggatggagggtcctcgctgggtttcaagcggagctacgaggaacacatccct
tacacacacatgaacggaggcaagaaaaacgggcggattctgaccttgcctcggtccaat
ccttcctaa

DBGET integrated database retrieval system