KEGG   Homo sapiens (human): 3643Help
Entry
3643              CDS       T01001                                 

Gene name
INSR, CD220, HHF5
Definition
insulin receptor (EC:2.7.10.1)
Orthology
K04527  
insulin receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adherens junction
Insulin signaling pathway
Ovarian steroidogenesis
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
Disease
H00719  
Leprechaunism
H00942  
Rabson-Mendenhall syndrome
H01228  
Insulin-resistant diabetes mellitus with acanthosis nigricans (IRAN)
H01267  
Familial hyperinsulinemic hypoglycemia (HHF)
Drug target
Insulin (human): 
Insulin (pork): 
Insulin lispro: 
Insulin aspart: 
Insulin glulisine: 
Insulin glargine: 
Insulin detemir: 
Insulin degludec: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3643 (INSR)
   04015 Rap1 signaling pathway
    3643 (INSR)
   04066 HIF-1 signaling pathway
    3643 (INSR)
   04068 FoxO signaling pathway
    3643 (INSR)
   04022 cGMP - PKG signaling pathway
    3643 (INSR)
   04151 PI3K-Akt signaling pathway
    3643 (INSR)
   04152 AMPK signaling pathway
    3643 (INSR)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    3643 (INSR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    3643 (INSR)
   04913 Ovarian Steroidogenesis
    3643 (INSR)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3643 (INSR)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    3643 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3643 (INSR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     3643 (INSR)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  InsR family [OT]
   3643 (INSR)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class II (Insulin receptor family)
   3643 (INSR)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   3643 (INSR)
Cellular antigens [BR:hsa04090]
 Proteins
  3643 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3-p13.2
AA seq 1382 aa AA seqDB search
MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAF
PNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCV
SRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSR
EKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSN
PS
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgggggccggcggggggcggcggccgcgccgctgctggtggcggtggccgcg
ctgctactgggcgccgcgggccacctgtaccccggagaggtgtgtcccggcatggatatc
cggaacaacctcactaggttgcatgagctggagaattgctctgtcatcgaaggacacttg
cagatactcttgatgttcaaaacgaggcccgaagatttccgagacctcagtttccccaaa
ctcatcatgatcactgattacttgctgctcttccgggtctatgggctcgagagcctgaag
gacctgttccccaacctcacggtcatccggggatcacgactgttctttaactacgcgctg
gtcatcttcgagatggttcacctcaaggaactcggcctctacaacctgatgaacatcacc
cggggttctgtccgcatcgagaagaacaatgagctctgttacttggccactatcgactgg
tcccgtatcctggattccgtggaggataattacatcgtgttgaacaaagatgacaacgag
gagtgtggagacatctgtccgggtaccgcgaagggcaagaccaactgccccgccaccgtc
atcaacgggcagtttgtcgaacgatgttggactcatagtcactgccagaaagtttgcccg
accatctgtaagtcacacggctgcaccgccgaaggcctctgttgccacagcgagtgcctg
ggcaactgttctcagcccgacgaccccaccaagtgcgtggcctgccgcaacttctacctg
gacggcaggtgtgtggagacctgcccgcccccgtactaccacttccaggactggcgctgt
gtgaacttcagcttctgccaggacctgcaccacaaatgcaagaactcgcggaggcagggc
tgccaccagtacgtcattcacaacaacaagtgcatccctgagtgtccctccgggtacacg
atgaattccagcaacttgctgtgcaccccatgcctgggtccctgtcccaaggtgtgccac
ctcctagaaggcgagaagaccatcgactcggtgacgtctgcccaggagctccgaggatgc
accgtcatcaacgggagtctgatcatcaacattcgaggaggcaacaatctggcagctgag
ctagaagccaacctcggcctcattgaagaaatttcagggtatctaaaaatccgccgatcc
tacgctctggtgtcactttccttcttccggaagttacgtctgattcgaggagagaccttg
gaaattgggaactactccttctatgccttggacaaccagaacctaaggcagctctgggac
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccactataaccccaaa
ctctgcttgtcagaaatccacaagatggaagaagtttcaggaaccaaggggcgccaggag
agaaacgacattgccctgaagaccaatggggaccaggcatcctgtgaaaatgagttactt
aaattttcttacattcggacatcttttgacaagatcttgctgagatgggagccgtactgg
ccccccgacttccgagacctcttggggttcatgctgttctacaaagaggccccttatcag
aatgtgacggagttcgacgggcaggatgcgtgtggttccaacagttggacggtggtagac
attgacccacccctgaggtccaacgaccccaaatcacagaaccacccagggtggctgatg
cggggtctcaagccctggacccagtatgccatctttgtgaagaccctggtcaccttttcg
gatgaacgccggacctatggggccaagagtgacatcatttatgtccagacagatgccacc
aacccctctgtgcccctggatccaatctcagtgtctaactcatcatcccagattattctg
aagtggaaaccaccctccgaccccaatggcaacatcacccactacctggttttctgggag
aggcaggcggaagacagtgagctgttcgagctggattattgcctcaaagggctgaagctg
ccctcgaggacctggtctccaccattcgagtctgaagattctcagaagcacaaccagagt
gagtatgaggattcggccggcgaatgctgctcctgtccaaagacagactctcagatcctg
aaggagctggaggagtcctcgtttaggaagacgtttgaggattacctgcacaacgtggtt
ttcgtccccagaaaaacctcttcaggcactggtgccgaggaccctaggccatctcggaaa
cgcaggtcccttggcgatgttgggaatgtgacggtggccgtgcccacggtggcagctttc
cccaacacttcctcgaccagcgtgcccacgagtccggaggagcacaggccttttgagaag
gtggtgaacaaggagtcgctggtcatctccggcttgcgacacttcacgggctatcgcatc
gagctgcaggcttgcaaccaggacacccctgaggaacggtgcagtgtggcagcctacgtc
agtgcgaggaccatgcctgaagccaaggctgatgacattgttggccctgtgacgcatgaa
atctttgagaacaacgtcgtccacttgatgtggcaggagccgaaggagcccaatggtctg
atcgtgctgtatgaagtgagttatcggcgatatggtgatgaggagctgcatctctgcgtc
tcccgcaagcacttcgctctggaacggggctgcaggctgcgtgggctgtcaccggggaac
tacagcgtgcgaatccgggccacctcccttgcgggcaacggctcttggacggaacccacc
tatttctacgtgacagactatttagacgtcccgtcaaatattgcaaaaattatcatcggc
cccctcatctttgtctttctcttcagtgttgtgattggaagtatttatctattcctgaga
aagaggcagccagatgggccgctgggaccgctttacgcttcttcaaaccctgagtatctc
agtgccagtgatgtgtttccatgctctgtgtacgtgccggacgagtgggaggtgtctcga
gagaagatcaccctccttcgagagctggggcagggctccttcggcatggtgtatgagggc
aatgccagggacatcatcaagggtgaggcagagacccgcgtggcggtgaagacggtcaac
gagtcagccagtctccgagagcggattgagttcctcaatgaggcctcggtcatgaagggc
ttcacctgccatcacgtggtgcgcctcctgggagtggtgtccaagggccagcccacgctg
gtggtgatggagctgatggctcacggagacctgaagagctacctccgttctctgcggcca
gaggctgagaataatcctggccgccctccccctacccttcaagagatgattcagatggcg
gcagagattgctgacgggatggcctacctgaacgccaagaagtttgtgcatcgggacctg
gcagcgagaaactgcatggtcgcccatgattttactgtcaaaattggagactttggaatg
accagagacatctatgaaacggattactaccggaaagggggcaagggtctgctccctgta
cggtggatggcaccggagtccctgaaggatggggtcttcaccacttcttctgacatgtgg
tcctttggcgtggtcctttgggaaatcaccagcttggcagaacagccttaccaaggcctg
tctaatgaacaggtgttgaaatttgtcatggatggagggtatctggatcaacccgacaac
tgtccagagagagtcactgacctcatgcgcatgtgctggcaattcaaccccaagatgagg
ccaaccttcctggagattgtcaacctgctcaaggacgacctgcaccccagctttccagag
gtgtcgttcttccacagcgaggagaacaaggctcccgagagtgaggagctggagatggag
tttgaggacatggagaatgtgcccctggaccgttcctcgcactgtcagagggaggaggcg
gggggccgggatggagggtcctcgctgggtttcaagcggagctacgaggaacacatccct
tacacacacatgaacggaggcaagaaaaacgggcggattctgaccttgcctcggtccaat
ccttcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system