KEGG   Homo sapiens (human): 3654Help
Entry
3654              CDS       T01001                                 

Gene name
IRAK1, IRAK, pelle
Definition
interleukin-1 receptor-associated kinase 1 (EC:2.7.11.1)
Orthology
K04730  
interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
Toll-like receptor signaling pathway
Neurotrophin signaling pathway
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Measles
Epstein-Barr virus infection
Module
Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    3654 (IRAK1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    3654 (IRAK1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3654 (IRAK1)
  Nervous system
   04722 Neurotrophin signaling pathway
    3654 (IRAK1)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    3654 (IRAK1)
   05152 Tuberculosis
    3654 (IRAK1)
   05162 Measles
    3654 (IRAK1)
   05169 Epstein-Barr virus infection
    3654 (IRAK1)
   05145 Toxoplasmosis
    3654 (IRAK1)
   05140 Leishmaniasis
    3654 (IRAK1)
   05142 Chagas disease (American trypanosomiasis)
    3654 (IRAK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     3654 (IRAK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  IRAK family
   3654 (IRAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 682 aa AA seqDB search
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS
IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK
PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL
HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP
RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQENSYVSSTGRAHSGAAPWQPLAAPSGA
SAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESS
WGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSS
SLPGLGLEQDRQGPEESDEFQS
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggccggggggccgggcccgggggagcccgcagcccccggcgcccagcacttcttgtac
gaggtgccgccctgggtcatgtgccgcttctacaaagtgatggacgccctggagcccgcc
gactggtgccagttcgccgccctgatcgtgcgcgaccagaccgagctgcggctgtgcgag
cgctccgggcagcgcacggccagcgtcctgtggccctggatcaaccgcaacgcccgtgtg
gccgacctcgtgcacatcctcacgcacctgcagctgctccgtgcgcgggacatcatcaca
gcctggcaccctcccgccccgcttccgtccccaggcaccactgccccgaggcccagcagc
atccctgcacccgccgaggccgaggcctggagcccccggaagttgccatcctcagcctcc
accttcctctccccagcttttccaggctcccagacccattcagggcctgagctcggcctg
gtcccaagccctgcttccctgtggcctccaccgccatctccagccccttcttctaccaag
ccaggcccagagagctcagtgtccctcctgcagggagcccgcccctttccgttttgctgg
cccctctgtgagatttcccggggcacccacaacttctcggaggagctcaagatcggggag
ggtggctttgggtgcgtgtaccgggcggtgatgaggaacacggtgtatgctgtgaagagg
ctgaaggagaacgctgacctggagtggactgcagtgaagcagagcttcctgaccgaggtg
gagcagctgtccaggtttcgtcacccaaacattgtggactttgctggctactgtgctcag
aacggcttctactgcctggtgtacggcttcctgcccaacggctccctggaggaccgtctc
cactgccagacccaggcctgcccacctctctcctggcctcagcgactggacatccttctg
ggtacagcccgggcaattcagtttctacatcaggacagccccagcctcatccatggagac
atcaagagttccaacgtccttctggatgagaggctgacacccaagctgggagactttggc
ctggcccggttcagccgctttgccgggtccagccccagccagagcagcatggtggcccgg
acacagacagtgcggggcaccctggcctacctgcccgaggagtacatcaagacgggaagg
ctggctgtggacacggacaccttcagctttggggtggtagtgctagagaccttggctggt
cagagggctgtgaagacgcacggtgccaggaccaagtatctgaaagacctggtggaagag
gaggctgaggaggctggagtggctttgagaagcacccagagcacactgcaagcaggtctg
gctgcagatgcctgggctgctcccatcgccatgcagatctacaagaagcacctggacccc
aggcccgggccctgcccacctgagctgggcctgggcctgggccagctggcctgctgctgc
ctgcaccgccgggccaaaaggaggcctcctatgacccaggagaactcctacgtgtccagc
actggcagagcccacagtggggctgctccatggcagcccctggcagcgccatcaggagcc
agtgcccaggcagcagagcagctgcagagaggccccaaccagcccgtggagagtgacgag
agcctaggcggcctctctgctgccctgcgctcctggcacttgactccaagctgccctctg
gacccagcacccctcagggaggccggctgtcctcagggggacacggcaggagaatcgagc
tgggggagtggcccaggatcccggcccacagccgtggaaggactggcccttggcagctct
gcatcatcgtcgtcagagccaccgcagattatcatcaaccctgcccgacagaagatggtc
cagaagctggccctgtacgaggatggggccctggacagcctgcagctgctgtcgtccagc
tccctcccaggcttgggcctggaacaggacaggcaggggcccgaagaaagtgatgaattt
cagagctga

DBGET integrated database retrieval system