KEGG   Homo sapiens (human): 3654Help
Entry
3654              CDS       T01001                                 

Gene name
IRAK1, IRAK, pelle
Definition
interleukin-1 receptor-associated kinase 1 (EC:2.7.11.1)
Orthology
K04730  
interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
Toll-like receptor signaling pathway
Neurotrophin signaling pathway
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Measles
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 682 aa AA seqDB search
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS
IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK
PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL
HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP
RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQENSYVSSTGRAHSGAAPWQPLAAPSGA
SAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESS
WGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSS
SLPGLGLEQDRQGPEESDEFQS
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggccggggggccgggcccgggggagcccgcagcccccggcgcccagcacttcttgtac
gaggtgccgccctgggtcatgtgccgcttctacaaagtgatggacgccctggagcccgcc
gactggtgccagttcgccgccctgatcgtgcgcgaccagaccgagctgcggctgtgcgag
cgctccgggcagcgcacggccagcgtcctgtggccctggatcaaccgcaacgcccgtgtg
gccgacctcgtgcacatcctcacgcacctgcagctgctccgtgcgcgggacatcatcaca
gcctggcaccctcccgccccgcttccgtccccaggcaccactgccccgaggcccagcagc
atccctgcacccgccgaggccgaggcctggagcccccggaagttgccatcctcagcctcc
accttcctctccccagcttttccaggctcccagacccattcagggcctgagctcggcctg
gtcccaagccctgcttccctgtggcctccaccgccatctccagccccttcttctaccaag
ccaggcccagagagctcagtgtccctcctgcagggagcccgcccctttccgttttgctgg
cccctctgtgagatttcccggggcacccacaacttctcggaggagctcaagatcggggag
ggtggctttgggtgcgtgtaccgggcggtgatgaggaacacggtgtatgctgtgaagagg
ctgaaggagaacgctgacctggagtggactgcagtgaagcagagcttcctgaccgaggtg
gagcagctgtccaggtttcgtcacccaaacattgtggactttgctggctactgtgctcag
aacggcttctactgcctggtgtacggcttcctgcccaacggctccctggaggaccgtctc
cactgccagacccaggcctgcccacctctctcctggcctcagcgactggacatccttctg
ggtacagcccgggcaattcagtttctacatcaggacagccccagcctcatccatggagac
atcaagagttccaacgtccttctggatgagaggctgacacccaagctgggagactttggc
ctggcccggttcagccgctttgccgggtccagccccagccagagcagcatggtggcccgg
acacagacagtgcggggcaccctggcctacctgcccgaggagtacatcaagacgggaagg
ctggctgtggacacggacaccttcagctttggggtggtagtgctagagaccttggctggt
cagagggctgtgaagacgcacggtgccaggaccaagtatctgaaagacctggtggaagag
gaggctgaggaggctggagtggctttgagaagcacccagagcacactgcaagcaggtctg
gctgcagatgcctgggctgctcccatcgccatgcagatctacaagaagcacctggacccc
aggcccgggccctgcccacctgagctgggcctgggcctgggccagctggcctgctgctgc
ctgcaccgccgggccaaaaggaggcctcctatgacccaggagaactcctacgtgtccagc
actggcagagcccacagtggggctgctccatggcagcccctggcagcgccatcaggagcc
agtgcccaggcagcagagcagctgcagagaggccccaaccagcccgtggagagtgacgag
agcctaggcggcctctctgctgccctgcgctcctggcacttgactccaagctgccctctg
gacccagcacccctcagggaggccggctgtcctcagggggacacggcaggagaatcgagc
tgggggagtggcccaggatcccggcccacagccgtggaaggactggcccttggcagctct
gcatcatcgtcgtcagagccaccgcagattatcatcaaccctgcccgacagaagatggtc
cagaagctggccctgtacgaggatggggccctggacagcctgcagctgctgtcgtccagc
tccctcccaggcttgggcctggaacaggacaggcaggggcccgaagaaagtgatgaattt
cagagctga

DBGET integrated database retrieval system