KEGG   Homo sapiens (human): 3655Help
Entry
3655              CDS       T01001                                 

Gene name
ITGA6, CD49f, ITGA6B, VLA-6
Definition
integrin, alpha 6
Orthology
K06485  
integrin alpha 6
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Toxoplasmosis
Pathways in cancer
Small cell lung cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Disease
H00586  
Epidermolysis bullosa, junctional
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q31.1
AA seq 1073 aa AA seqDB search
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTK
PTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNR
IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRK
KREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNST
FLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFILWKCGFFKRNKKDHYDATYHKAEIHAQPSDKERLTSDA
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgggcagctgtgcttgctctacctgtcggcggggctcctgtcccggctc
ggcgcagccttcaacttggacactcgggaggacaacgtgatccggaaatatggagacccc
gggagcctcttcggcttctcgctggccatgcactggcaactgcagcccgaggacaagcgg
ctgttgctcgtgggggccccgcgggcagaagcgcttccactgcagagagccaacagaacg
ggagggctgtacagctgcgacatcaccgcccgggggccatgcacgcggatcgagtttgat
aacgatgctgaccccacgtcagaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccagggggcaaggtcgtgacatgtgctcaccgatatgaaaaaaggcagcat
gttaatacgaagcaggaatcccgagacatctttgggcggtgttatgtcctgagtcagaat
ctcaggattgaagacgatatggatgggggagattggagcttttgtgatgggcgattgaga
ggccatgagaaatttggctcttgccagcaaggtgtagcagctacttttactaaagacttt
cattacattgtatttggagccccgggtacttataactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgagcatgatgaaagtctcgttcctgttcctgctaacagttacttaggtttt
tctttggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
cccagagccaatcacagtggagccgtggttttgctgaagagagacatgaagtctgcacat
ctcctccctgagcacatattcgatggagaaggtctggcctcttcatttggctatgatgtg
gcggtggtggacctcaacaaggatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaagttggaggtgcagtgtatgtctacatgaaccagcaaggcaga
tggaataatgtgaagccaattcgtcttaatggaaccaaagattctatgtttggcattgca
gtaaaaaatattggagatattaatcaagatggctacccagatattgcagttggagctccg
tatgatgacttgggaaaggtttttatctatcatggatctgcaaatggaataaataccaaa
ccaacacaggttctcaagggtatatcaccttattttggatattcaattgctggaaacatg
gaccttgatcgaaattcctaccctgatgttgctgttggttccctctcagattcagtaact
attttcagatcccggcctgtgattaatattcagaaaaccatcacagtaactcctaacaga
attgacctccgccagaaaacagcgtgtggggcgcctagtgggatatgcctccaggttaaa
tcctgttttgaatatactgctaaccccgctggttataatccttcaatatcaattgtgggc
acacttgaagctgaaaaagaaagaagaaaatctgggctatcctcaagagttcagtttcga
aaccaaggttctgagcccaaatatactcaagaactaactctgaagaggcagaaacagaaa
gtgtgcatggaggaaaccctgtggctacaggataatatcagagataaactgcgtcccatt
cccataactgcctcagtggagatccaagagccaagctctcgtaggcgagtgaattcactt
ccagaagttcttccaattctgaattcagatgaacccaagacagctcatattgatgttcac
ttcttaaaagagggatgtggagacgacaatgtatgtaacagcaaccttaaactagaatat
aaattttgcacccgagaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agcccttccaacccaaggaatcccacaaaagatggcgatgacgcccatgaggctaaactg
attgcaacgtttccagacactttaacctattctgcatatagagaactgagggctttccct
gagaaacagttgagttgtgttgccaaccagaatggctcgcaagctgactgtgagctcgga
aatccttttaaaagaaattcaaatgtcactttttatttggttttaagtacaactgaagtc
acctttgacaccccagatctggatattaatctgaagttagaaacaacaagcaatcaagat
aatttggctccaattacagctaaagcaaaagtggttattgaactgcttttatcggtctcg
ggagttgctaaaccttcccaggtgtattttggaggtacagttgttggcgagcaagctatg
aaatctgaagatgaagtgggaagtttaatagagtatgaattcagggtaataaacttaggt
aaacctcttacaaacctcggcacagcaaccttgaacattcagtggccaaaagaaattagc
aatgggaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaaggtaact
tgtgagccacaaaaggagataaactccctgaacctaacggagtctcacaactcaagaaag
aaacgggaaattactgaaaaacagatagatgataacagaaaattttctttatttgctgaa
agaaaataccagactcttaactgtagcgtgaacgtgaactgtgtgaacatcagatgcccg
ctgcgggggctggacagcaaggcgtctcttattttgcgctcgaggttatggaacagcaca
tttctagaggaatattccaaactgaactacttggacattctcatgcgagccttcattgat
gtgactgctgctgccgaaaatatcaggctgccaaatgcaggcactcaggttcgagtgact
gtgtttccctcaaagactgtagctcagtattcgggagtaccttggtggatcatcctagtg
gctattctcgctgggatcttgatgcttgctttattagtgtttatactatggaagtgtggt
ttcttcaagagaaataagaaagatcattatgatgccacatatcacaaggctgagatccat
gctcagccatctgataaagagaggcttacttctgatgcatag

DBGET integrated database retrieval system