KEGG   Homo sapiens (human): 3659Help
Entry
3659              CDS       T01001                                 

Gene name
IRF1, IRF-1, MAR
Definition
interferon regulatory factor 1
Orthology
K09444  
interferon regulatory factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Prolactin signaling pathway
Pertussis
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    3659 (IRF1)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    3659 (IRF1)
   05160 Hepatitis C
    3659 (IRF1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    3659 (IRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 325 aa AA seqDB search
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQR
KERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALT
PALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKL
LEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN
MDATWLDSLLTPVRLPSIQAIPCAP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcactcggatgcgcatgagaccctggctagagatgcagattaattccaaccaa
atcccggggctcatctggattaataaagaggagatgatcttccagatcccatggaagcat
gctgccaagcatggctgggacatcaacaaggatgcctgtttgttccggagctgggccatt
cacacaggccgatacaaagcaggggaaaaggagccagatcccaagacgtggaaggccaac
tttcgctgtgccatgaactccctgccagatatcgaggaggtgaaagaccagagcaggaac
aagggcagctcagctgtgcgagtgtaccggatgcttccacctctcaccaagaaccagaga
aaagaaagaaagtcgaagtccagccgagatgctaagagcaaggccaagaggaagtcatgt
ggggattccagccctgataccttctctgatggactcagcagctccactctgcctgatgac
cacagcagctacacagttccaggctacatgcaggacttggaggtggagcaggccctgact
ccagcactgtcgccatgtgctgtcagcagcactctccccgactggcacatcccagtggaa
gttgtgccggacagcaccagtgatctgtacaacttccaggtgtcacccatgccctccacc
tctgaagctacaacagatgaggatgaggaagggaaattacctgaggacatcatgaagctc
ttggagcagtcggagtggcagccaacaaacgtggatgggaaggggtacctactcaatgaa
cctggagtccagcccacctctgtctatggagactttagctgtaaggaggagccagaaatt
gacagcccagggggggatattgggctgagtctacagcgtgtcttcacagatctgaagaac
atggatgccacctggctggacagcctgctgaccccagtccggttgccctccatccaggcc
attccctgtgcaccgtag

DBGET integrated database retrieval system