KEGG   Homo sapiens (human): 3661Help
Entry
3661              CDS       T01001                                 

Gene name
IRF3
Definition
interferon regulatory factor 3
Orthology
K05411  
interferon regulatory factor 3
Organism
hsa  Homo sapiens (human)
Pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Pertussis
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3661 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    3661 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    3661 (IRF3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    3661 (IRF3)
  Infectious diseases
   05133 Pertussis
    3661 (IRF3)
   05162 Measles
    3661 (IRF3)
   05164 Influenza A
    3661 (IRF3)
   05161 Hepatitis B
    3661 (IRF3)
   05160 Hepatitis C
    3661 (IRF3)
   05168 Herpes simplex infection
    3661 (IRF3)
   05169 Epstein-Barr virus infection
    3661 (IRF3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    3661 (IRF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3-q13.4
AA seq 452 aa AA seqDB search
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQP
DTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPT
PFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPG
WPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVPKDKEGGVFDLGPFIVGSWAPRSDYLHGRKRTLTTLCPLVLCGGVMAPG
PAVDQEARDGQGCAHVPQGLGRNGPGRGCLLPGEYCGPAHFQQPPTLPHLRPVQGLPAGL
GGGHGFPGPWGELSPRSSWCASNPPVPHHLNQ
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccccaaagccacggatcctgccctggctggtgtcgcagctggacctggggcaa
ctggagggcgtggcctgggtgaacaagagccgcacgcgcttccgcatcccttggaagcac
ggcctacggcaggatgcacagcaggaggatttcggaatcttccaggcctgggccgaggcc
actggtgcatatgttcccgggagggataagccagacctgccaacctggaagaggaatttc
cgctctgccctcaaccgcaaagaagggttgcgtttagcagaggaccggagcaaggaccct
cacgacccacataaaatctacgagtttgtgaactcaggagttggggacttttcccagcca
gacacctctccggacaccaatggtggaggcagtacttctgatacccaggaagacattctg
gatgagttactgggtaacatggtgttggccccactcccagatccgggacccccaagcctg
gctgtagcccctgagccctgccctcagcccctgcggagccccagcttggacaatcccact
cccttcccaaacctggggccctctgagaacccactgaagcggctgttggtgccgggggaa
gagtgggagttcgaggtgacagccttctaccggggccgccaagtcttccagcagaccatc
tcctgcccggagggcctgcggctggtggggtccgaagtgggagacaggacgctgcctgga
tggccagtcacactgccagaccctggcatgtccctgacagacaggggagtgatgagctac
gtgaggcatgtgctgagctgcctgggtgggggactggctctctggcgggccgggcagtgg
ctctgggcccagcggctggggcactgccacacatactgggcagtgagcgaggagctgctc
cccaacagcgggcatgggcctgatggcgaggtccccaaggacaaggaaggaggcgtgttt
gacctggggcccttcattgtaggctcctgggcccccagatctgattaccttcacggaagg
aagcggacgctcaccacgctatgccctctggttctgtgtgggggagtcatggccccagga
ccagccgtggaccaagaggctcgtgatggtcaaggttgtgcccacgtgcctcagggcctt
ggtagaaatggcccgggtagggggtgcctcctccctggagaatactgtggacctgcacat
ttccaacagccacccactctccctcacctccgaccagtacaaggcctacctgcaggactt
ggtggagggcatggatttccagggccctggggagagctgagccctcgctcctcatggtgt
gcctccaacccccctgttccccaccacctcaaccaataa

DBGET integrated database retrieval system