KEGG   Homo sapiens (human): 3665Help
Entry
3665              CDS       T01001                                 

Gene name
IRF7, IRF-7H, IRF7A, IRF7B, IRF7C, IRF7H
Definition
interferon regulatory factor 7
Orthology
K09447  
interferon regulatory factor 7
Organism
hsa  Homo sapiens (human)
Pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Viral carcinogenesis
Class
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5
AA seq 503 aa AA seqDB search
MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIF
KAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHK
VYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKG
DLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAV
ETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTV
LQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLE
LRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR
QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSL
CLSSANSLYDDIECFLMELEQPA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggccttggctcctgagagggcagccccacgcgtgctgttcggagagtggctccttgga
gagatcagcagcggctgctatgaggggctgcagtggctggacgaggcccgcacctgtttc
cgcgtgccctggaagcacttcgcgcgcaaggacctgagcgaggccgacgcgcgcatcttc
aaggcctgggctgtggcccgcggcaggtggccgcctagcagcaggggaggtggcccgccc
cccgaggctgagactgcggagcgcgccggctggaaaaccaacttccgctgcgcactgcgc
agcacgcgtcgcttcgtgatgctgcgggataactcgggggacccggccgacccgcacaag
gtgtacgcgctcagccgggagctgtgctggcgagaaggcccaggcacggaccagactgag
gcagaggcccccgcagctgtcccaccaccacagggtgggcccccagggccattcctggca
cacacacatgctggactccaagccccaggccccctccctgccccagctggtgacaagggg
gacctcctgctccaggcagtgcaacagagctgcctggcagaccatctgctgacagcgtca
tggggggcagatccagtcccaaccaaggctcctggagagggacaagaagggcttcccctg
actggggcctgtgctggaggcccagggctccctgctggggagctgtacgggtgggcagta
gagacgacccccagccccgggccccagcccgcggcactaacgacaggcgaggccgcggcc
ccagagtccccgcaccaggcagagccgtacctgtcaccctccccaagcgcctgcaccgcg
gtgcaagagcccagcccaggggcgctggacgtgaccatcatgtacaagggccgcacggtg
ctgcagaaggtggtgggacacccgagctgcacgttcctatacggccccccagacccagct
gtccgggccacagacccccagcaggtagcattccccagccctgccgagctcccggaccag
aagcagctgcgctacacggaggaactgctgcggcacgtggcccctgggttgcacctggag
cttcgggggccacagctgtgggcccggcgcatgggcaagtgcaaggtgtactgggaggtg
ggcggacccccaggctccgccagcccctccaccccagcctgcctgctgcctcggaactgt
gacacccccatcttcgacttcagagtcttcttccaagagctggtggaattccgggcacgg
cagcgccgtggctccccacgctataccatctacctgggcttcgggcaggacctgtcagct
gggaggcccaaggagaagagcctggtcctggtgaagctggaaccctggctgtgccgagtg
cacctagagggcacgcagcgtgagggtgtgtcttccctggatagcagcagcctcagcctc
tgcctgtccagcgccaacagcctctatgacgacatcgagtgcttccttatggagctggag
cagcccgcctag

DBGET integrated database retrieval system