KEGG   Homo sapiens (human): 367Help
Entry
367               CDS       T01001                                 

Gene name
AR, AIS, DHTR, HUMARA, HYSP1, KD, NR3C4, SBMA, SMAX1, TFM
Definition
androgen receptor
Orthology
K08557  
androgen receptor
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Pathways in cancer
Prostate cancer
Disease
H00024  
Prostate cancer
H00062  
Spinal and bulbar muscular atrophy (SBMA)
H00608  
46,XY disorders of sex development (Disorders in androgen synthesis or action)
H00609  
46,XY disorders of sex development (Other)
Drug target
Androstanolone: 
Stanozolol: 
Metandienone: 
Metenolone: 
Oxymetholone: 
Quinbolone: 
Prasterone: 
Oxandrolone: 
Norethandrolone: 
Nandrolone: 
Ethylestrenol: 
Oxabolone cipionate: 
Fluoxymesterone: 
Methyltestosterone: 
Testosterone: 
Mesterolone: 
Cyproterone: 
Danazol: 
Flutamide: 
Nilutamide: 
Bicalutamide: 
Other: 
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq12
AA seq 920 aa AA seqDB search
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ
QQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQ
SALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSAD
LKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELC
KAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAG
KSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQ
SRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA
GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAP
YGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRL
ETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN
DCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKL
TVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWA
KALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSR
MYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD
RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEII
SVQVPKILSGKVKPIYFHTQ
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgcagttagggctgggaagggtctaccctcggccgccgtccaagacctaccga
ggagctttccagaatctgttccagagcgtgcgcgaagtgatccagaacccgggccccagg
cacccagaggccgcgagcgcagcacctcccggcgccagtttgctgctgctgcagcagcag
cagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcaa
gagactagccccaggcagcagcagcagcagcagggtgaggatggttctccccaagcccat
cgtagaggccccacaggctacctggtcctggatgaggaacagcaaccttcacagccgcag
tcggccctggagtgccaccccgagagaggttgcgtcccagagcctggagccgccgtggcc
gccagcaaggggctgccgcagcagctgccagcacctccggacgaggatgactcagctgcc
ccatccacgttgtccctgctgggccccactttccccggcttaagcagctgctccgctgac
cttaaagacatcctgagcgaggccagcaccatgcaactccttcagcaacagcagcaggaa
gcagtatccgaaggcagcagcagcgggagagcgagggaggcctcgggggctcccacttcc
tccaaggacaattacttagggggcacttcgaccatttctgacaacgccaaggagttgtgt
aaggcagtgtcggtgtccatgggcctgggtgtggaggcgttggagcatctgagtccaggg
gaacagcttcggggggattgcatgtacgccccacttttgggagttccacccgctgtgcgt
cccactccttgtgccccattggccgaatgcaaaggttctctgctagacgacagcgcaggc
aagagcactgaagatactgctgagtattcccctttcaagggaggttacaccaaagggcta
gaaggcgagagcctaggctgctctggcagcgctgcagcagggagctccgggacacttgaa
ctgccgtctaccctgtctctctacaagtccggagcactggacgaggcagctgcgtaccag
agtcgcgactactacaactttccactggctctggccggaccgccgccccctccgccgcct
ccccatccccacgctcgcatcaagctggagaacccgctggactacggcagcgcctgggcg
gctgcggcggcgcagtgccgctatggggacctggcgagcctgcatggcgcgggtgcagcg
ggacccggttctgggtcaccctcagccgccgcttcctcatcctggcacactctcttcaca
gccgaagaaggccagttgtatggaccgtgtggtggtggtgggggtggtggcggcggcggc
ggcggcggcggcggcggcggcggcggcggcggcggcggcgaggcgggagctgtagccccc
tacggctacactcggccccctcaggggctggcgggccaggaaagcgacttcaccgcacct
gatgtgtggtaccctggcggcatggtgagcagagtgccctatcccagtcccacttgtgtc
aaaagcgaaatgggcccctggatggatagctactccggaccttacggggacatgcgtttg
gagactgccagggaccatgttttgcccattgactattactttccaccccagaagacctgc
ctgatctgtggagatgaagcttctgggtgtcactatggagctctcacatgtggaagctgc
aaggtcttcttcaaaagagccgctgaagggaaacagaagtacctgtgcgccagcagaaat
gattgcactattgataaattccgaaggaaaaattgtccatcttgtcgtcttcggaaatgt
tatgaagcagggatgactctgggagcccggaagctgaagaaacttggtaatctgaaacta
caggaggaaggagaggcttccagcaccaccagccccactgaggagacaacccagaagctg
acagtgtcacacattgaaggctatgaatgtcagcccatctttctgaatgtcctggaagcc
attgagccaggtgtagtgtgtgctggacacgacaacaaccagcccgactcctttgcagcc
ttgctctctagcctcaatgaactgggagagagacagcttgtacacgtggtcaagtgggcc
aaggccttgcctggcttccgcaacttacacgtggacgaccagatggctgtcattcagtac
tcctggatggggctcatggtgtttgccatgggctggcgatccttcaccaatgtcaactcc
aggatgctctacttcgcccctgatctggttttcaatgagtaccgcatgcacaagtcccgg
atgtacagccagtgtgtccgaatgaggcacctctctcaagagtttggatggctccaaatc
accccccaggaattcctgtgcatgaaagcactgctactcttcagcattattccagtggat
gggctgaaaaatcaaaaattctttgatgaacttcgaatgaactacatcaaggaactcgat
cgtatcattgcatgcaaaagaaaaaatcccacatcctgctcaagacgcttctaccagctc
accaagctcctggactccgtgcagcctattgcgagagagctgcatcagttcacttttgac
ctgctaatcaagtcacacatggtgagcgtggactttccggaaatgatggcagagatcatc
tctgtgcaagtgcccaagatcctttctgggaaagtcaagcccatctatttccacacccag
tga

DBGET integrated database retrieval system