KEGG   Homo sapiens (human): 3672Help
Entry
3672              CDS       T01001                                 

Gene name
ITGA1, CD49a, VLA1
Definition
integrin, alpha 1
Orthology
K06480  
integrin alpha 1
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3672 (ITGA1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3672 (ITGA1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3672 (ITGA1)
  Cell communication
   04510 Focal adhesion
    3672 (ITGA1)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3672 (ITGA1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3672 (ITGA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3672 (ITGA1)
   05414 Dilated cardiomyopathy (DCM)
    3672 (ITGA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3672 (ITGA1)
Cellular antigens [BR:hsa04090]
 Proteins
  3672 (ITGA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q11.2
AA seq 1179 aa AA seqDB search
MAPRPRARPGVAVACCWLLTVVLRCCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKNRTGDVYKCPVGRGESLPCVKLDLPVNTSIPNVTEVKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVQECSTQLDIVIVLDGS
NSIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEDE
NIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKTLGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKASQIIIPRNTT
FNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQT
LSGEQIGSYFGSILTTTDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQM
SLEPIKQTCCSSRQHNSCTTENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHG
GAVYIYHGSGKTIRKEYAQRIPSGGDGKTLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAA
LFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINATVCFDVKLKSKEDTIYEADL
QYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFN
LTDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFN
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRRGEMVT
FKILFQFNTSYLMENVTIYLSATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYH
ISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPT
GLSSSENANCRPHIFEDPFSINSGKKMTTSTDHLKRGTILDCNTCKFATITCNLTSSDIS
QVNVSLILWKPTFIKSYFSSLNLTIRGELRSENASLVLSSSNQKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atggcccctcggccccgcgcccgcccaggggtcgctgtcgcctgctgctggctcctcact
gttgttctacgctgctgcgtatcattcaatgttgatgtgaaaaattcaatgactttcagc
ggcccggtggaagacatgtttggatatactgttcaacaatatgaaaatgaagaaggaaaa
tgggtgcttattggttctccgttagttggccaacccaaaaacagaactggagatgtctat
aagtgtccagttgggagaggtgaatcattaccttgtgtaaagttggatctaccagttaat
acatcaattcccaatgtcacagaagtaaaggagaacatgacatttggatcaactttagtc
accaacccaaatggaggatttctggcttgtgggcccttatatgcctatagatgtggacat
ttgcattacacaactggaatctgttctgacgtcagccccacatttcaagtcgtgaattcc
attgcccctgtacaagaatgcagcactcaactggacatagtcatagtgctggatggttcc
aacagtatttacccatgggacagtgttacagcttttttaaatgaccttcttgaaagaatg
gatattggtcctaaacagacacaggttggaattgtacagtatggagaaaacgtgacccat
gagttcaacctcaataagtattcttccaccgaagaggtacttgttgcagcaaagaaaata
gtccagagaggtggccgccagactatgacagctcttggaatagacacagcaagaaaggag
gcattcacggaagcccggggtgcccgaagaggagttaaaaaagtcatggttattgtgaca
gatggagagtctcatgacaatcatcgactgaagaaggtcatccaagactgtgaagatgaa
aacattcaacggttttccatagctattcttggcagctataaccgaggaaatttaagcact
gaaaaatttgtggaggaaataaaatcaattgcaagtgaacccactgaaaagcatttcttc
aatgtctctgatgaattggctctagtcaccattgttaaaactctgggagaaagaatattt
gccctggaagccacagctgaccagtcagcagcttcatttgaaatggaaatgtctcagact
ggcttcagtgctcattattcacaggactgggtcatgcttggagcagtaggagcctatgat
tggaatggaacagttgtcatgcagaaggctagtcaaatcataatccctcgaaacacaacc
tttaatgttgagtctaccaaaaagaatgaaccgcttgcttcttatttaggttacactgta
aactctgctactgcttcttctggagatgtgctctatattgctggacagcctcggtacaat
catacaggccaggtcattatctacaggatggaagatggaaacatcaaaattctccagacg
ctcagtggagaacagattggttcctactttggcagtattttaacaacaactgacattgac
aaggattctaatactgacattcttctagtcggagcccctatgtacatgggaacagagaag
gaggagcaaggaaaagtgtatgtgtatgctctcaatcagacaaggtttgaatatcaaatg
agcctggaacctattaagcagacgtgctgttcatctcggcagcacaattcatgcacaaca
gaaaacaaaaatgagccatgcggggctcgttttggaactgcaattgctgctgtaaaagac
ctcaatcttgatggatttaatgacatcgtgataggagctccgctggaagatgatcacggg
ggagctgtgtacatttatcatggaagtggcaagactataaggaaagagtatgcacaacgt
attccatcaggtggggatggtaagacactgaaattttttggccagtctatccacggagaa
atggatttaaatggtgacggtctgacagatgtgactattgggggccttggtggtgctgcc
ctcttctggtcccgagatgtggccgtagttaaagtgaccatgaattttgagccaaataaa
gtgaatattcaaaagaaaaactgccatatggagggaaaggaaacagtatgcataaatgct
acagtgtgttttgatgtgaaattaaagtctaaagaagacacgatttatgaagctgatttg
cagtaccgtgtcaccctagattcactaagacaaatatcacgaagttttttctctggaact
caagagagaaaggttcaaaggaacatcacagttcgaaaatcagaatgcactaagcactcc
ttctacatgttggacaagcatgactttcaggactctgtgagaataacgttggactttaat
cttaccgatccagaaaatgggcctgttcttgatgattctctaccaaactcagtacatgaa
tatattccctttgccaaagattgtggaaataaggaaaaatgtatctcagacctcagcctg
catgtcgccaccactgaaaaggacctgctgattgtccgatcccagaatgataagttcaac
gttagcctcacagtcaaaaatacaaaggacagtgcctataacaccaggacaatagtgcat
tattctccaaatctagttttttcaggaattgaggctatccaaaaagacagttgtgaatct
aatcataatatcacatgtaaagttggatatcccttcctgagaagaggagagatggtaact
ttcaaaatattgtttcagtttaacacatcctatctcatggaaaatgtgaccatttattta
agtgcaacaagtgacagcgaagaacctcctgaaaccctttctgataatgtagtaaacatt
tctatcccggtaaaatatgaagttggactacagttttacagctctgcaagtgaataccac
atttcaattgctgccaatgagacagtccctgaagttattaattctactgaggacattgga
aatgaaattaatatcttctacttgattagaaaaagtggatcttttccaatgccagagctt
aagctgtcaatttcattccccaatatgacatcaaatggttaccctgtgctgtacccaact
ggattgtcatcttctgagaatgcaaactgcagaccccatatctttgaggatcctttcagt
atcaactctggaaagaaaatgactacatcaactgaccatctcaaacgaggcacaattctg
gactgcaatacatgtaaatttgctaccatcacatgtaatctcacttcttctgacatcagc
caagtcaatgtttcgcttatcttgtggaaaccaacttttataaaatcatatttttccagc
ttaaatcttactataaggggagaacttcggagtgaaaatgcatctctggttttaagtagc
agcaatcaaaaaagagagcttgctattcaaatatccaaagatgggctaccgggcagagtg
ccattatgggtcatcctgctgagtgcttttgccggattgttgctgttaatgctgctcatt
ttagcactgtggaagattggattcttcaaaagaccactgaaaaagaaaatggagaaatga

DBGET integrated database retrieval system