KEGG   Homo sapiens (human): 3678Help
Entry
3678              CDS       T01001                                 

Gene name
ITGA5, CD49e, FNRA, VLA-5, VLA5A
Definition
(RefSeq) integrin subunit alpha 5
  KO
K06484  
integrin alpha 5
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Shigellosis
Pertussis
Proteoglycans in cancer
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3678 (ITGA5)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3678 (ITGA5)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3678 (ITGA5)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3678 (ITGA5)
  Cellular commiunity
   04510 Focal adhesion
    3678 (ITGA5)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3678 (ITGA5)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    3678 (ITGA5)
   05205 Proteoglycans in cancer
    3678 (ITGA5)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3678 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3678 (ITGA5)
   05414 Dilated cardiomyopathy (DCM)
    3678 (ITGA5)
  Infectious diseases
   05131 Shigellosis
    3678 (ITGA5)
   05133 Pertussis
    3678 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    3678 (ITGA5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3678 (ITGA5)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     VLA-5 Cell adhesion molecules (CAMs)
      3678 (ITGA5)
 5. Cadherin Family
  Clustered protocadherin
   PCDHA; protocadherin alpha [KO:K16493]
    VLA-5 Cell adhesion molecules (CAMs)
     3678 (ITGA5)
 7. Others
  TNFSF5, CD40L; tumor necrosis factor (ligand) superfamily, member 5 [KO:K03161]
   VLA-5 Cell adhesion molecules (CAMs)
    3678 (ITGA5)
  SDC1; syndecan 1 [KO:K06257]
    3678 (ITGA5)
  SDC4; syndecan 4 [KO:K16338]
    3678 (ITGA5)
Cellular antigens [BR:hsa04090]
 Proteins
  3678 (ITGA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 1098 aa AA seqDB search
MPPRQPPRQAGGGLSREFGKLLPALSHSPLGGLGSGSGSVAPGQGRAGAMGSRTPESPLH
AVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPGT
DGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGE
EPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAP
CRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLI
NLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDI
RSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMDRTPDGRPQEVGRVYVYLQH
PAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGG
PGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRP
IVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQ
KQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFS
LDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDK
NALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVC
DLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQ
VTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQ
ALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKC
PEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRIL
PRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLP
YGTAMEKAQLKPPATSDA
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atgcccccccgccagccccctcggcaggcggggggagggctcagccgggagtttggcaaa
ctcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcggtg
gccccaggacagggaagagcgggcgctatggggagccggacgccagagtcccctctccac
gccgtgcagctgcgctggggcccccggcgccgacccccgctgctgccgctgctgttgctg
ctgctgccgccgccacccagggtcgggggcttcaacttagacgcggaggccccagcagta
ctctcggggcccccgggctccttcttcggattctcagtggagttttaccggccgggaaca
gacggggtcagtgtgctggtgggagcacccaaggctaataccagccagccaggagtgctg
cagggtggtgctgtctacctctgtccttggggtgccagccccacacagtgcacccccatt
gaatttgacagcaaaggctctcggctcctggagtcctcactgtccagctcagagggagag
gagcctgtggagtacaagtccttgcagtggttcggggcaacagttcgagcccatggctcc
tccatcttggcatgcgctccactgtacagctggcgcacagagaaggagccactgagcgac
cccgtgggcacctgctacctctccacagataacttcacccgaattctggagtatgcaccc
tgccgctcagatttcagctgggcagcaggacagggttactgccaaggaggcttcagtgcc
gagttcaccaagactggccgtgtggttttaggtggaccaggaagctatttctggcaaggc
cagatcctgtctgccactcaggagcagattgcagaatcttattaccccgagtacctgatc
aacctggttcaggggcagctgcagactcgccaggccagttccatctatgatgacagctac
ctaggatactctgtggctgttggtgaattcagtggtgatgacacagaagactttgttgct
ggtgtgcccaaagggaacctcacttacggctatgtcaccatccttaatggctcagacatt
cgatccctctacaacttctcaggggaacagatggcctcctactttggctatgcagtggcc
gccacagacgtcaatggggacgggctggatgacttgctggtgggggcacccctgctcatg
gatcggacccctgacgggcggcctcaggaggtgggcagggtctacgtctacctgcagcac
ccagccggcatagagcccacgcccacccttaccctcactggccatgatgagtttggccga
tttggcagctccttgacccccctgggggacctggaccaggatggctacaatgatgtggcc
atcggggctccctttggtggggagacccagcagggagtagtgtttgtatttcctgggggc
ccaggagggctgggctctaagccttcccaggttctgcagcccctgtgggcagccagccac
accccagacttctttggctctgcccttcgaggaggccgagacctggatggcaatggatat
cctgatctgattgtggggtcctttggtgtggacaaggctgtggtatacaggggccgcccc
atcgtgtccgctagtgcctccctcaccatcttccccgccatgttcaacccagaggagcgg
agctgcagcttagaggggaaccctgtggcctgcatcaaccttagcttctgcctcaatgct
tctggaaaacacgttgctgactccattggtttcacagtggaacttcagctggactggcag
aagcagaagggaggggtacggcgggcactgttcctggcctccaggcaggcaaccctgacc
cagaccctgctcatccagaatggggctcgagaggattgcagagagatgaagatctacctc
aggaacgagtcagaatttcgagacaaactctcgccgattcacatcgctctcaacttctcc
ttggacccccaagccccagtggacagccacggcctcaggccagccctacattatcagagc
aagagccggatagaggacaaggctcagatcttgctggactgtggagaagacaacatctgt
gtgcctgacctgcagctggaagtgtttggggagcagaaccatgtgtacctgggtgacaag
aatgccctgaacctcactttccatgcccagaatgtgggtgagggtggcgcctatgaggct
gagcttcgggtcaccgcccctccagaggctgagtactcaggactcgtcagacacccaggg
aacttctccagcctgagctgtgactactttgccgtgaaccagagccgcctgctggtgtgt
gacctgggcaaccccatgaaggcaggagccagtctgtggggtggccttcggtttacagtc
cctcatctccgggacactaagaaaaccatccagtttgacttccagatcctcagcaagaat
ctcaacaactcgcaaagcgacgtggtttcctttcggctctccgtggaggctcaggcccag
gtcaccctgaacggtgtctccaagcctgaggcagtgctattcccagtaagcgactggcat
ccccgagaccagcctcagaaggaggaggacctgggacctgctgtccaccatgtctatgag
ctcatcaaccaaggccccagctccattagccagggtgtgctggaactcagctgtccccag
gctctggaaggtcagcagctcctatatgtgaccagagttacgggactcaactgcaccacc
aatcaccccattaacccaaagggcctggagttggatcccgagggttccctgcaccaccag
caaaaacgggaagctccaagccgcagctctgcttcctcgggacctcagatcctgaaatgc
ccggaggctgagtgtttcaggctgcgctgtgagctcgggcccctgcaccaacaagagagc
caaagtctgcagttgcatttccgagtctgggccaagactttcttgcagcgggagcaccag
ccatttagcctgcagtgtgaggctgtgtacaaagccctgaagatgccctaccgaatcctg
cctcggcagctgccccaaaaagagcgtcaggtggccacagctgtgcaatggaccaaggca
gaaggcagctatggcgtcccactgtggatcatcatcctagccatcctgtttggcctcctg
ctcctaggtctactcatctacatcctctacaagcttggattcttcaaacgctccctccca
tatggcaccgccatggaaaaagctcagctcaagcctccagccacctctgatgcctga

DBGET integrated database retrieval system