KEGG   Homo sapiens (human): 3678Help
Entry
3678              CDS       T01001                                 

Gene name
ITGA5, CD49e, FNRA, VLA5A
Definition
integrin, alpha 5 (fibronectin receptor, alpha polypeptide)
Orthology
K06484  
integrin alpha 5
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Shigellosis
Pertussis
Proteoglycans in cancer
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q11-q13
AA seq 1049 aa AA seqDB search
MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFF
GFSVEFYRPGTDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRL
LESSLSSSEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLST
DNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQ
IAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTY
GYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMDRTPDGRPQ
EVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGET
QQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFG
VDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSI
GFTVELQLDWQKQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDK
LSPIHIALNFSLDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVF
GEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDY
FAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVV
SFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSI
SQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRS
SASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAV
YKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYIL
YKLGFFKRSLPYGTAMEKAQLKPPATSDA
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atggggagccggacgccagagtcccctctccacgccgtgcagctgcgctggggcccccgg
cgccgacccccgctgctgccgctgctgttgctgctgctgccgccgccacccagggtcggg
ggcttcaacttagacgcggaggccccagcagtactctcggggcccccgggctccttcttc
ggattctcagtggagttttaccggccgggaacagacggggtcagtgtgctggtgggagca
cccaaggctaataccagccagccaggagtgctgcagggtggtgctgtctacctctgtcct
tggggtgccagccccacacagtgcacccccattgaatttgacagcaaaggctctcggctc
ctggagtcctcactgtccagctcagagggagaggagcctgtggagtacaagtccttgcag
tggttcggggcaacagttcgagcccatggctcctccatcttggcatgcgctccactgtac
agctggcgcacagagaaggagccactgagcgaccccgtgggcacctgctacctctccaca
gataacttcacccgaattctggagtatgcaccctgccgctcagatttcagctgggcagca
ggacagggttactgccaaggaggcttcagtgccgagttcaccaagactggccgtgtggtt
ttaggtggaccaggaagctatttctggcaaggccagatcctgtctgccactcaggagcag
attgcagaatcttattaccccgagtacctgatcaacctggttcaggggcagctgcagact
cgccaggccagttccatctatgatgacagctacctaggatactctgtggctgttggtgaa
ttcagtggtgatgacacagaagactttgttgctggtgtgcccaaagggaacctcacttac
ggctatgtcaccatccttaatggctcagacattcgatccctctacaacttctcaggggaa
cagatggcctcctactttggctatgcagtggccgccacagacgtcaatggggacgggctg
gatgacttgctggtgggggcacccctgctcatggatcggacccctgacgggcggcctcag
gaggtgggcagggtctacgtctacctgcagcacccagccggcatagagcccacgcccacc
cttaccctcactggccatgatgagtttggccgatttggcagctccttgacccccctgggg
gacctggaccaggatggctacaatgatgtggccatcggggctccctttggtggggagacc
cagcagggagtagtgtttgtatttcctgggggcccaggagggctgggctctaagccttcc
caggttctgcagcccctgtgggcagccagccacaccccagacttctttggctctgccctt
cgaggaggccgagacctggatggcaatggatatcctgatctgattgtggggtcctttggt
gtggacaaggctgtggtatacaggggccgccccatcgtgtccgctagtgcctccctcacc
atcttccccgccatgttcaacccagaggagcggagctgcagcttagaggggaaccctgtg
gcctgcatcaaccttagcttctgcctcaatgcttctggaaaacacgttgctgactccatt
ggtttcacagtggaacttcagctggactggcagaagcagaagggaggggtacggcgggca
ctgttcctggcctccaggcaggcaaccctgacccagaccctgctcatccagaatggggct
cgagaggattgcagagagatgaagatctacctcaggaacgagtcagaatttcgagacaaa
ctctcgccgattcacatcgctctcaacttctccttggacccccaagccccagtggacagc
cacggcctcaggccagccctacattatcagagcaagagccggatagaggacaaggctcag
atcttgctggactgtggagaagacaacatctgtgtgcctgacctgcagctggaagtgttt
ggggagcagaaccatgtgtacctgggtgacaagaatgccctgaacctcactttccatgcc
cagaatgtgggtgagggtggcgcctatgaggctgagcttcgggtcaccgcccctccagag
gctgagtactcaggactcgtcagacacccagggaacttctccagcctgagctgtgactac
tttgccgtgaaccagagccgcctgctggtgtgtgacctgggcaaccccatgaaggcagga
gccagtctgtggggtggccttcggtttacagtccctcatctccgggacactaagaaaacc
atccagtttgacttccagatcctcagcaagaatctcaacaactcgcaaagcgacgtggtt
tcctttcggctctccgtggaggctcaggcccaggtcaccctgaacggtgtctccaagcct
gaggcagtgctattcccagtaagcgactggcatccccgagaccagcctcagaaggaggag
gacctgggacctgctgtccaccatgtctatgagctcatcaaccaaggccccagctccatt
agccagggtgtgctggaactcagctgtccccaggctctggaaggtcagcagctcctatat
gtgaccagagttacgggactcaactgcaccaccaatcaccccattaacccaaagggcctg
gagttggatcccgagggttccctgcaccaccagcaaaaacgggaagctccaagccgcagc
tctgcttcctcgggacctcagatcctgaaatgcccggaggctgagtgtttcaggctgcgc
tgtgagctcgggcccctgcaccaacaagagagccaaagtctgcagttgcatttccgagtc
tgggccaagactttcttgcagcgggagcaccagccatttagcctgcagtgtgaggctgtg
tacaaagccctgaagatgccctaccgaatcctgcctcggcagctgccccaaaaagagcgt
caggtggccacagctgtgcaatggaccaaggcagaaggcagctatggcgtcccactgtgg
atcatcatcctagccatcctgtttggcctcctgctcctaggtctactcatctacatcctc
tacaagcttggattcttcaaacgctccctcccatatggcaccgccatggaaaaagctcag
ctcaagcctccagccacctctgatgcctga

DBGET integrated database retrieval system