KEGG   Homo sapiens (human): 3683Help
Entry
3683              CDS       T01001                                 

Gene name
ITGAL, CD11A, LFA-1, LFA1A
Definition
integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide)
Orthology
K05718  
integrin alpha L
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Cell adhesion molecules (CAMs)
Natural killer cell mediated cytotoxicity
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Malaria
Staphylococcus aureus infection
HTLV-I infection
Epstein-Barr virus infection
Rheumatoid arthritis
Viral myocarditis
Drug target
Efalizumab: 
Other: 
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 1086 aa AA seqDB search
MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGA
PGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILFAAVQFSTSYK
TEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYVATEVFREELGARPDATKVLIIIT
DGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVKILDTFEKLKDL
FTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSRGHAVVGAVGAKDWAGGFLDLKAD
LQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLLASGAPRYQHMGRVLLFQEPQGGG
HWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLIGAPLFYGEQRGGRVFIYQRRQLG
FEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVAVGAPLEEQGAVYIFNGRHGGLSP
QPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVAVGAESQMIVLSSRPVVDMVTLMS
FSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLIPQFQGRLVANLTYTLQLDGHRTR
RRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQDLISPINVSLNFSLWEEEGTPRDQ
RAGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEANLRVSFSPARSRALRLTAFASLSVE
LSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQIPVSCEELPEESRLLSRALSCNVS
SPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTCNNEDSDLLEDNSATTIIPILYPIN
ILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPSEGPI
THQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIE
ASSMFSLCSSLSISFNSSKHFHLYGSNASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLL
LLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSE
SGGGKD
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattcctgcatcactgtgatggccatggcgctgctgtctgggttctttttcttc
gcgccggcctcgagctacaacctggacgtgcggggcgcgcggagcttctccccaccgcgc
gccgggaggcactttggataccgcgtcctgcaggtcggaaacggggtcatcgtgggagct
ccaggggaggggaacagcacaggaagcctctatcagtgccagtcgggcacaggacactgc
ctgccagtcaccctgagaggttccaactatacctccaagtacttgggaatgaccttggca
acagaccccacagatggaagcattttgtttgctgctgttcagttttccacaagctacaaa
acagaatttgatttctcagattatgttaaacggaaggaccctgatgctctgctgaagcat
gtaaagcacatgttgctgttgaccaatacctttggtgccatcaattatgtcgcgacagag
gtgttccgggaggagctgggggcccggccagatgccaccaaagtgcttatcatcatcacg
gatggggaggccactgacagtggcaacatcgatgcggccaaagacatcatccgctacatc
atcgggattggaaagcattttcagaccaaggagagtcaggagaccctccacaaatttgca
tcaaaacccgcgagcgagtttgtgaaaattctggacacatttgagaagctgaaagatcta
ttcactgagctgcagaagaagatctatgtcattgagggcacaagcaaacaggacctgact
tccttcaacatggagctgtcctccagcggcatcagtgctgacctcagcaggggccatgca
gtcgtgggggcagtaggagccaaggactgggctgggggctttcttgacctgaaggcagac
ctgcaggatgacacatttattgggaatgaaccattgacaccagaagtgagagcaggctat
ttgggttacaccgtgacctggctgccctcccggcaaaagacttcgttgctggcctcggga
gcccctcgataccagcacatgggccgagtgctgctgttccaagagccacagggcggagga
cactggagccaggtccagacaatccatgggacccagattggctcttatttcggtggggag
ctgtgtggcgtcgacgtggaccaagatggggagacagagctgctgctgattggtgcccca
ctgttctatggggagcagagaggaggccgggtgtttatctaccagagaagacagttgggg
tttgaagaagtctcagagctgcagggggaccccggctacccactcgggcggtttggagaa
gccatcactgctctgacagacatcaacggcgatgggctggtagacgtggctgtgggggcc
cctctggaggagcagggggctgtgtacatcttcaatgggaggcacggggggcttagtccc
cagccaagtcagcggatagaagggacccaagtgctctcaggaattcagtggtttggacgc
tccatccatggggtgaaggaccttgaaggggatggcttggcagatgtggctgtgggggct
gagagccagatgatcgtgctgagctcccggcccgtggtggatatggtcaccctgatgtcc
ttctctccagctgagatcccagtgcatgaagtggagtgctcctattcaaccagtaacaag
atgaaagaaggagttaatatcacaatctgtttccagatcaagtctctcatcccccagttc
caaggccgcctggttgccaatctcacttacactctgcagctggatggccaccggaccaga
agacgggggttgttcccaggagggagacatgaactcagaaggaatatagctgtcaccacc
agcatgtcatgcactgacttctcatttcatttcccggtatgtgttcaagacctcatctcc
cccatcaatgtttccctgaatttctctctttgggaggaggaagggacaccgagggaccaa
agggcgggcaaggacataccgcccatcctgagaccctccctgcactcggaaacctgggag
atcccttttgagaagaactgtggggaggacaagaagtgtgaggcaaacttgagagtgtcc
ttctctcctgcaagatccagagccctgcgtctaactgcttttgccagcctctctgtggag
ctgagcctgagtaacttggaagaagatgcttactgggtccagctggacctgcacttcccc
ccgggactctccttccgcaaggtggagatgctgaagccccatagccagatacctgtgagc
tgcgaggagcttcctgaagagtccaggcttctgtccagggcattatcttgcaatgtgagc
tctcccatcttcaaagcaggccactcggttgctctgcagatgatgtttaatacactggta
aacagctcctggggggactcggttgaattgcacgccaatgtgacctgtaacaatgaggac
tcagacctcctggaggacaactcagccactaccatcatccccatcctgtaccccatcaac
atcctcatccaggaccaagaagactccacactctatgtcagtttcacccccaaaggcccc
aagatccaccaagtcaagcacatgtaccaggtgaggatccagccttccatccacgaccac
aacatacccaccctggaggctgtggttggggtgccacagcctcccagcgaggggcccatc
acacaccagtggagcgtgcagatggagcctcccgtgccctgccactatgaggatctggag
aggctcccggatgcagctgagccttgtctccccggagccctgttccgctgccctgttgtc
ttcaggcaggagatcctcgtccaagtgatcgggactctggagctggtgggagagatcgag
gcctcttccatgttcagcctctgcagctccctctccatctccttcaacagcagcaagcat
ttccacctctatggcagcaacgcctccctggcccaggttgtcatgaaggttgacgtggtg
tatgagaagcagatgctctacctctacgtgctgagcggcatcggggggctgctgctgctg
ctgctcattttcatagtgctgtacaaggttggtttcttcaaacggaacctgaaggagaag
atggaggctggcagaggtgtcccgaatggaatccctgcagaagactctgagcagctggca
tctgggcaagaggctggggatcccggctgcctgaagcccctccatgagaaggactctgag
agtggtggtggcaaggactga

DBGET integrated database retrieval system