KEGG   Homo sapiens (human): 3683Help
Entry
3683              CDS       T01001                                 

Gene name
ITGAL, CD11A, LFA-1, LFA1A
Definition
(RefSeq) integrin subunit alpha L
  KO
K05718  integrin alpha L
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04650  Natural killer cell mediated cytotoxicity
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05144  Malaria
hsa05150  Staphylococcus aureus infection
hsa05166  HTLV-I infection
hsa05169  Epstein-Barr virus infection
hsa05323  Rheumatoid arthritis
hsa05416  Viral myocarditis
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Efalizumab: D03959
Erlizumab: D04045
Lifitegrast (DG01389): D10374 D10392
Rovelizumab: D08993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    3683 (ITGAL)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3683 (ITGAL)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3683 (ITGAL)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3683 (ITGAL)
   04670 Leukocyte transendothelial migration
    3683 (ITGAL)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    3683 (ITGAL)
  Cardiovascular diseases
   05416 Viral myocarditis
    3683 (ITGAL)
  Infectious diseases
   05150 Staphylococcus aureus infection
    3683 (ITGAL)
   05166 HTLV-I infection
    3683 (ITGAL)
   05169 Epstein-Barr virus infection
    3683 (ITGAL)
   05144 Malaria
    3683 (ITGAL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3683 (ITGAL)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3683 (ITGAL)
CD molecules [BR:hsa04090]
 Proteins
  3683 (ITGAL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 3683
NCBI-ProteinID: NP_002200
OMIM: 153370
HGNC: 6148
Ensembl: ENSG00000005844
Vega: OTTHUMG00000176964
Pharos: P20701(Tclin)
UniProt: P20701 B2RAL6
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 1170 aa AA seqDB search
MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGA
PGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCD
QNTYLSGLCYLFRQNLQGPMLQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMK
DVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYV
ATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLH
KFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSR
GHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLL
ASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLI
GAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVA
VGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVA
VGAESQMIVLSSRPVVDMVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLI
PQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQD
LISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEAN
LRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQ
IPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTC
NNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPS
IHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFR
CPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFHLYGSNASLAQVVMK
VDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDS
EQLASGQEAGDPGCLKPLHEKDSESGGGKD
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattcctgcatcactgtgatggccatggcgctgctgtctgggttctttttcttc
gcgccggcctcgagctacaacctggacgtgcggggcgcgcggagcttctccccaccgcgc
gccgggaggcactttggataccgcgtcctgcaggtcggaaacggggtcatcgtgggagct
ccaggggaggggaacagcacaggaagcctctatcagtgccagtcgggcacaggacactgc
ctgccagtcaccctgagaggttccaactatacctccaagtacttgggaatgaccttggca
acagaccccacagatggaagcattttggcctgtgaccctgggctgtctcgaacgtgtgac
cagaacacctatctgagtggcctgtgttacctcttccgccagaatctgcagggtcccatg
ctgcaggggcgccctggttttcaggaatgtatcaagggcaacgtagacctggtatttctg
tttgatggttcgatgagcttgcagccagatgaatttcagaaaattctggacttcatgaag
gatgtgatgaagaaactcagcaacacttcgtaccagtttgctgctgttcagttttccaca
agctacaaaacagaatttgatttctcagattatgttaaacggaaggaccctgatgctctg
ctgaagcatgtaaagcacatgttgctgttgaccaatacctttggtgccatcaattatgtc
gcgacagaggtgttccgggaggagctgggggcccggccagatgccaccaaagtgcttatc
atcatcacggatggggaggccactgacagtggcaacatcgatgcggccaaagacatcatc
cgctacatcatcgggattggaaagcattttcagaccaaggagagtcaggagaccctccac
aaatttgcatcaaaacccgcgagcgagtttgtgaaaattctggacacatttgagaagctg
aaagatctattcactgagctgcagaagaagatctatgtcattgagggcacaagcaaacag
gacctgacttccttcaacatggagctgtcctccagcggcatcagtgctgacctcagcagg
ggccatgcagtcgtgggggcagtaggagccaaggactgggctgggggctttcttgacctg
aaggcagacctgcaggatgacacatttattgggaatgaaccattgacaccagaagtgaga
gcaggctatttgggttacaccgtgacctggctgccctcccggcaaaagacttcgttgctg
gcctcgggagcccctcgataccagcacatgggccgagtgctgctgttccaagagccacag
ggcggaggacactggagccaggtccagacaatccatgggacccagattggctcttatttc
ggtggggagctgtgtggcgtcgacgtggaccaagatggggagacagagctgctgctgatt
ggtgccccactgttctatggggagcagagaggaggccgggtgtttatctaccagagaaga
cagttggggtttgaagaagtctcagagctgcagggggaccccggctacccactcgggcgg
tttggagaagccatcactgctctgacagacatcaacggcgatgggctggtagacgtggct
gtgggggcccctctggaggagcagggggctgtgtacatcttcaatgggaggcacgggggg
cttagtccccagccaagtcagcggatagaagggacccaagtgctctcaggaattcagtgg
tttggacgctccatccatggggtgaaggaccttgaaggggatggcttggcagatgtggct
gtgggggctgagagccagatgatcgtgctgagctcccggcccgtggtggatatggtcacc
ctgatgtccttctctccagctgagatcccagtgcatgaagtggagtgctcctattcaacc
agtaacaagatgaaagaaggagttaatatcacaatctgtttccagatcaagtctctcatc
ccccagttccaaggccgcctggttgccaatctcacttacactctgcagctggatggccac
cggaccagaagacgggggttgttcccaggagggagacatgaactcagaaggaatatagct
gtcaccaccagcatgtcatgcactgacttctcatttcatttcccggtatgtgttcaagac
ctcatctcccccatcaatgtttccctgaatttctctctttgggaggaggaagggacaccg
agggaccaaagggcgcagggcaaggacataccgcccatcctgagaccctccctgcactcg
gaaacctgggagatcccttttgagaagaactgtggggaggacaagaagtgtgaggcaaac
ttgagagtgtccttctctcctgcaagatccagagccctgcgtctaactgcttttgccagc
ctctctgtggagctgagcctgagtaacttggaagaagatgcttactgggtccagctggac
ctgcacttccccccgggactctccttccgcaaggtggagatgctgaagccccatagccag
atacctgtgagctgcgaggagcttcctgaagagtccaggcttctgtccagggcattatct
tgcaatgtgagctctcccatcttcaaagcaggccactcggttgctctgcagatgatgttt
aatacactggtaaacagctcctggggggactcggttgaattgcacgccaatgtgacctgt
aacaatgaggactcagacctcctggaggacaactcagccactaccatcatccccatcctg
taccccatcaacatcctcatccaggaccaagaagactccacactctatgtcagtttcacc
cccaaaggccccaagatccaccaagtcaagcacatgtaccaggtgaggatccagccttcc
atccacgaccacaacatacccaccctggaggctgtggttggggtgccacagcctcccagc
gaggggcccatcacacaccagtggagcgtgcagatggagcctcccgtgccctgccactat
gaggatctggagaggctcccggatgcagctgagccttgtctccccggagccctgttccgc
tgccctgttgtcttcaggcaggagatcctcgtccaagtgatcgggactctggagctggtg
ggagagatcgaggcctcttccatgttcagcctctgcagctccctctccatctccttcaac
agcagcaagcatttccacctctatggcagcaacgcctccctggcccaggttgtcatgaag
gttgacgtggtgtatgagaagcagatgctctacctctacgtgctgagcggcatcgggggg
ctgctgctgctgctgctcattttcatagtgctgtacaaggttggtttcttcaaacggaac
ctgaaggagaagatggaggctggcagaggtgtcccgaatggaatccctgcagaagactct
gagcagctggcatctgggcaagaggctggggatcccggctgcctgaagcccctccatgag
aaggactctgagagtggtggtggcaaggactga

DBGET integrated database retrieval system