KEGG   Homo sapiens (human): 3684Help
Entry
3684              CDS       T01001                                 

Gene name
ITGAM, CD11B, CR3A, MAC-1, MAC1A, MO1A, SLEB6
Definition
integrin, alpha M (complement component 3 receptor 3 subunit)
Orthology
K06461  
integrin alpha M
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Phagosome
Cell adhesion molecules (CAMs)
Hematopoietic cell lineage
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Pertussis
Legionellosis
Leishmaniasis
Amoebiasis
Staphylococcus aureus infection
Tuberculosis
Transcriptional misregulation in cancer
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    3684 (ITGAM)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3684 (ITGAM)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3684 (ITGAM)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3684 (ITGAM)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3684 (ITGAM)
   04670 Leukocyte transendothelial migration
    3684 (ITGAM)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3684 (ITGAM)
  Infectious diseases
   05133 Pertussis
    3684 (ITGAM)
   05134 Legionellosis
    3684 (ITGAM)
   05150 Staphylococcus aureus infection
    3684 (ITGAM)
   05152 Tuberculosis
    3684 (ITGAM)
   05146 Amoebiasis
    3684 (ITGAM)
   05140 Leishmaniasis
    3684 (ITGAM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3684 (ITGAM)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   ICAM family
    ICAM1; intercellular adhesion molecule 1 [KO:K06490]
     CR3, Mac-1 Cell adhesion molecules (CAMs)
      3684 (ITGAM)
    ICAM2; intercellular adhesion molecule 2 [KO:K06523]
      3684 (ITGAM)
  Neural system
   N/0 subfamily
    THY1, CD90; Thy-1 cell surface antigen [KO:K06514]
      3684 (ITGAM)
Cellular antigens [BR:hsa04090]
 Proteins
  3684 (ITGAM)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Adhesion molecules of cell surface (General comment) Cell attachment, inflammation, transition
  3684 (ITGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 1152 aa AA seqDB search
MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQR
GSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVK
GLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQL
KKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFN
ITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQEL
NTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAIT
SNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV
LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAP
HYYEQTRGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAI
GAPGEEDNRGAVYLFHGTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVD
LTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKS
TRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPN
CIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDL
SITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ
RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKAN
VTSENNMPRTNKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNL
GQRSLPISLVFLVPVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVV
NCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLIVSTAEILFNDSVFT
LLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDM
MSEGGPPGAEPQ
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atggctctcagagtccttctgttaacagccttgaccttatgtcatgggttcaacttggac
actgaaaacgcaatgaccttccaagagaacgcaaggggcttcgggcagagcgtggtccag
cttcagggatccagggtggtggttggagccccccaggagatagtggctgccaaccaaagg
ggcagcctctaccagtgcgactacagcacaggctcatgcgagcccatccgcctgcaggtc
cccgtggaggccgtgaacatgtccctgggcctgtccctggcagccaccaccagcccccct
cagctgctggcctgtggtcccaccgtgcaccagacttgcagtgagaacacgtatgtgaaa
gggctctgcttcctgtttggatccaacctacggcagcagccccagaagttcccagaggcc
ctccgagggtgtcctcaagaggatagtgacattgccttcttgattgatggctctggtagc
atcatcccacatgactttcggcggatgaaggagtttgtctcaactgtgatggagcaatta
aaaaagtccaaaaccttgttctctttgatgcagtactctgaagaattccggattcacttt
accttcaaagagttccagaacaaccctaacccaagatcactggtgaagccaataacgcag
ctgcttgggcggacacacacggccacgggcatccgcaaagtggtacgagagctgtttaac
atcaccaacggagcccgaaagaatgcctttaagatcctagttgtcatcacggatggagaa
aagtttggcgatcccttgggatatgaggatgtcatccctgaggcagacagagagggagtc
attcgctacgtcattggggtgggagatgccttccgcagtgagaaatcccgccaagagctt
aataccatcgcatccaagccgcctcgtgatcacgtgttccaggtgaataactttgaggct
ctgaagaccattcagaaccagcttcgggagaagatctttgcgatcgagggtactcagaca
ggaagtagcagctcctttgagcatgagatgtctcaggaaggcttcagcgctgccatcacc
tctaatggccccttgctgagcactgtggggagctatgactgggctggtggagtctttcta
tatacatcaaaggagaaaagcaccttcatcaacatgaccagagtggattcagacatgaat
gatgcttacttgggttatgctgccgccatcatcttacggaaccgggtgcaaagcctggtt
ctgggggcacctcgatatcagcacatcggcctggtagcgatgttcaggcagaacactggc
atgtgggagtccaacgctaatgtcaagggcacccagatcggcgcctacttcggggcctcc
ctctgctccgtggacgtggacagcaacggcagcaccgacctggtcctcatcggggccccc
cattactacgagcagacccgagggggccaggtgtccgtgtgccccttgcccagggggagg
gctcggtggcagtgtgatgctgttctctacggggagcagggccaaccctggggccgcttt
ggggcagccctaacagtgctgggggacgtaaatggggacaagctgacggacgtggccatt
ggggccccaggagaggaggacaaccggggtgctgtttacctgtttcacggaacctcagga
tctggcatcagcccctcccatagccagcggatagcaggctccaagctctctcccaggctc
cagtattttggtcagtcactgagtgggggccaggacctcacaatggatggactggtagac
ctgactgtaggagcccaggggcacgtgctgctgctcaggtcccagccagtactgagagtc
aaggcaatcatggagttcaatcccagggaagtggcaaggaatgtatttgagtgtaatgat
caggtggtgaaaggcaaggaagccggagaggtcagagtctgcctccatgtccagaagagc
acacgggatcggctaagagaaggacagatccagagtgttgtgacttatgacctggctctg
gactccggccgcccacattcccgcgccgtcttcaatgagacaaagaacagcacacgcaga
cagacacaggtcttggggctgacccagacttgtgagaccctgaaactacagttgccgaat
tgcatcgaggacccagtgagccccattgtgctgcgcctgaacttctctctggtgggaacg
ccattgtctgctttcgggaacctccggccagtgctggcggaggatgctcagagactcttc
acagccttgtttccctttgagaagaattgtggcaatgacaacatctgccaggatgacctc
agcatcaccttcagtttcatgagcctggactgcctcgtggtgggtgggccccgggagttc
aacgtgacagtgactgtgagaaatgatggtgaggactcctacaggacacaggtcaccttc
ttcttcccgcttgacctgtcctaccggaaggtgtccacgctccagaaccagcgctcacag
cgatcctggcgcctggcctgtgagtctgcctcctccaccgaagtgtctggggccttgaag
agcaccagctgcagcataaaccaccccatcttcccggaaaactcagaggtcacctttaat
atcacgtttgatgtagactctaaggcttcccttggaaacaaactgctcctcaaggccaat
gtgaccagtgagaacaacatgcccagaaccaacaaaaccgaattccaactggagctgccg
gtgaaatatgctgtctacatggtggtcaccagccatggggtctccactaaatatctcaac
ttcacggcctcagagaataccagtcgggtcatgcagcatcaatatcaggtcagcaacctg
gggcagaggagcctccccatcagcctggtgttcttggtgcccgtccggctgaaccagact
gtcatatgggaccgcccccaggtcaccttctccgagaacctctcgagtacgtgccacacc
aaggagcgcttgccctctcactccgactttctggctgagcttcggaaggcccccgtggtg
aactgctccatcgctgtctgccagagaatccagtgtgacatcccgttctttggcatccag
gaagaattcaatgctaccctcaaaggcaacctctcgtttgactggtacatcaagacctcg
cataaccacctcctgatcgtgagcacagctgagatcttgtttaacgattccgtgttcacc
ctgctgccgggacagggggcgtttgtgaggtcccagacggagaccaaagtggagccgttc
gaggtccccaaccccctgccgctcatcgtgggcagctctgtcgggggactgctgctcctg
gccctcatcaccgccgcgctgtacaagctcggcttcttcaagcggcaatacaaggacatg
atgagtgaagggggtcccccgggggccgaaccccagtag

DBGET integrated database retrieval system