KEGG   Homo sapiens (human): 3684Help
Entry
3684              CDS       T01001                                 

Gene name
ITGAM, CD11B, CR3A, MAC-1, MAC1A, MO1A, SLEB6
Definition
(RefSeq) integrin subunit alpha M
  KO
K06461  integrin alpha M
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules (CAMs)
hsa04610  Complement and coagulation cascades
hsa04640  Hematopoietic cell lineage
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05146  Amoebiasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
N00112  AML1-ETO fusion to PU.1-mediated transcription
Drug target
Rovelizumab: D08993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    3684 (ITGAM)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3684 (ITGAM)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3684 (ITGAM)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3684 (ITGAM)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3684 (ITGAM)
   04610 Complement and coagulation cascades
    3684 (ITGAM)
   04670 Leukocyte transendothelial migration
    3684 (ITGAM)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3684 (ITGAM)
   05221 Acute myeloid leukemia
    3684 (ITGAM)
  Infectious diseases
   05133 Pertussis
    3684 (ITGAM)
   05134 Legionellosis
    3684 (ITGAM)
   05150 Staphylococcus aureus infection
    3684 (ITGAM)
   05152 Tuberculosis
    3684 (ITGAM)
   05146 Amoebiasis
    3684 (ITGAM)
   05140 Leishmaniasis
    3684 (ITGAM)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3684 (ITGAM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3684 (ITGAM)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3684 (ITGAM)
CD molecules [BR:hsa04090]
 Proteins
  3684 (ITGAM)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Adhesion molecules of cell surface (General comment) Cell attachment, inflammation, transition
   3684 (ITGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha VCBS FG-GAP_2
Motif
Other DBs
NCBI-GeneID: 3684
NCBI-ProteinID: NP_000623
OMIM: 120980
HGNC: 6149
Ensembl: ENSG00000169896
Vega: OTTHUMG00000176612
Pharos: P11215(Tbio)
UniProt: P11215
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 1152 aa AA seqDB search
MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQR
GSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVK
GLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQL
KKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFN
ITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQEL
NTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAIT
SNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV
LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAP
HYYEQTRGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAI
GAPGEEDNRGAVYLFHGTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVD
LTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKS
TRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPN
CIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDL
SITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ
RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKAN
VTSENNMPRTNKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNL
GQRSLPISLVFLVPVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVV
NCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLIVSTAEILFNDSVFT
LLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDM
MSEGGPPGAEPQ
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atggctctcagagtccttctgttaacagccttgaccttatgtcatgggttcaacttggac
actgaaaacgcaatgaccttccaagagaacgcaaggggcttcgggcagagcgtggtccag
cttcagggatccagggtggtggttggagccccccaggagatagtggctgccaaccaaagg
ggcagcctctaccagtgcgactacagcacaggctcatgcgagcccatccgcctgcaggtc
cccgtggaggccgtgaacatgtccctgggcctgtccctggcagccaccaccagcccccct
cagctgctggcctgtggtcccaccgtgcaccagacttgcagtgagaacacgtatgtgaaa
gggctctgcttcctgtttggatccaacctacggcagcagccccagaagttcccagaggcc
ctccgagggtgtcctcaagaggatagtgacattgccttcttgattgatggctctggtagc
atcatcccacatgactttcggcggatgaaggagtttgtctcaactgtgatggagcaatta
aaaaagtccaaaaccttgttctctttgatgcagtactctgaagaattccggattcacttt
accttcaaagagttccagaacaaccctaacccaagatcactggtgaagccaataacgcag
ctgcttgggcggacacacacggccacgggcatccgcaaagtggtacgagagctgtttaac
atcaccaacggagcccgaaagaatgcctttaagatcctagttgtcatcacggatggagaa
aagtttggcgatcccttgggatatgaggatgtcatccctgaggcagacagagagggagtc
attcgctacgtcattggggtgggagatgccttccgcagtgagaaatcccgccaagagctt
aataccatcgcatccaagccgcctcgtgatcacgtgttccaggtgaataactttgaggct
ctgaagaccattcagaaccagcttcgggagaagatctttgcgatcgagggtactcagaca
ggaagtagcagctcctttgagcatgagatgtctcaggaaggcttcagcgctgccatcacc
tctaatggccccttgctgagcactgtggggagctatgactgggctggtggagtctttcta
tatacatcaaaggagaaaagcaccttcatcaacatgaccagagtggattcagacatgaat
gatgcttacttgggttatgctgccgccatcatcttacggaaccgggtgcaaagcctggtt
ctgggggcacctcgatatcagcacatcggcctggtagcgatgttcaggcagaacactggc
atgtgggagtccaacgctaatgtcaagggcacccagatcggcgcctacttcggggcctcc
ctctgctccgtggacgtggacagcaacggcagcaccgacctggtcctcatcggggccccc
cattactacgagcagacccgagggggccaggtgtccgtgtgccccttgcccagggggagg
gctcggtggcagtgtgatgctgttctctacggggagcagggccaaccctggggccgcttt
ggggcagccctaacagtgctgggggacgtaaatggggacaagctgacggacgtggccatt
ggggccccaggagaggaggacaaccggggtgctgtttacctgtttcacggaacctcagga
tctggcatcagcccctcccatagccagcggatagcaggctccaagctctctcccaggctc
cagtattttggtcagtcactgagtgggggccaggacctcacaatggatggactggtagac
ctgactgtaggagcccaggggcacgtgctgctgctcaggtcccagccagtactgagagtc
aaggcaatcatggagttcaatcccagggaagtggcaaggaatgtatttgagtgtaatgat
caggtggtgaaaggcaaggaagccggagaggtcagagtctgcctccatgtccagaagagc
acacgggatcggctaagagaaggacagatccagagtgttgtgacttatgacctggctctg
gactccggccgcccacattcccgcgccgtcttcaatgagacaaagaacagcacacgcaga
cagacacaggtcttggggctgacccagacttgtgagaccctgaaactacagttgccgaat
tgcatcgaggacccagtgagccccattgtgctgcgcctgaacttctctctggtgggaacg
ccattgtctgctttcgggaacctccggccagtgctggcggaggatgctcagagactcttc
acagccttgtttccctttgagaagaattgtggcaatgacaacatctgccaggatgacctc
agcatcaccttcagtttcatgagcctggactgcctcgtggtgggtgggccccgggagttc
aacgtgacagtgactgtgagaaatgatggtgaggactcctacaggacacaggtcaccttc
ttcttcccgcttgacctgtcctaccggaaggtgtccacgctccagaaccagcgctcacag
cgatcctggcgcctggcctgtgagtctgcctcctccaccgaagtgtctggggccttgaag
agcaccagctgcagcataaaccaccccatcttcccggaaaactcagaggtcacctttaat
atcacgtttgatgtagactctaaggcttcccttggaaacaaactgctcctcaaggccaat
gtgaccagtgagaacaacatgcccagaaccaacaaaaccgaattccaactggagctgccg
gtgaaatatgctgtctacatggtggtcaccagccatggggtctccactaaatatctcaac
ttcacggcctcagagaataccagtcgggtcatgcagcatcaatatcaggtcagcaacctg
gggcagaggagcctccccatcagcctggtgttcttggtgcccgtccggctgaaccagact
gtcatatgggaccgcccccaggtcaccttctccgagaacctctcgagtacgtgccacacc
aaggagcgcttgccctctcactccgactttctggctgagcttcggaaggcccccgtggtg
aactgctccatcgctgtctgccagagaatccagtgtgacatcccgttctttggcatccag
gaagaattcaatgctaccctcaaaggcaacctctcgtttgactggtacatcaagacctcg
cataaccacctcctgatcgtgagcacagctgagatcttgtttaacgattccgtgttcacc
ctgctgccgggacagggggcgtttgtgaggtcccagacggagaccaaagtggagccgttc
gaggtccccaaccccctgccgctcatcgtgggcagctctgtcgggggactgctgctcctg
gccctcatcaccgccgcgctgtacaagctcggcttcttcaagcggcaatacaaggacatg
atgagtgaagggggtcccccgggggccgaaccccagtag

DBGET integrated database retrieval system