KEGG   Homo sapiens (human): 3685Help
Entry
3685              CDS       T01001                                 

Gene name
ITGAV, CD51, MSK8, VNRA, VTNR
Definition
(RefSeq) integrin subunit alpha V
  KO
K06487  
integrin alpha V
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Thyroid hormone signaling pathway
Pathways in cancer
Proteoglycans in cancer
Small cell lung cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3685 (ITGAV)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3685 (ITGAV)
   04514 Cell adhesion molecules (CAMs)
    3685 (ITGAV)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3685 (ITGAV)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3685 (ITGAV)
  Cellular commiunity
   04510 Focal adhesion
    3685 (ITGAV)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    3685 (ITGAV)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3685 (ITGAV)
   05205 Proteoglycans in cancer
    3685 (ITGAV)
   05222 Small cell lung cancer
    3685 (ITGAV)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3685 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3685 (ITGAV)
   05414 Dilated cardiomyopathy (DCM)
    3685 (ITGAV)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3685 (ITGAV)
  Exosomal proteins of epithelial cells
   3685 (ITGAV)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     VNR Cell adhesion molecules (CAMs)
      3685 (ITGAV)
   N/0 subfamily
    THY1, CD90; Thy-1 cell surface antigen [KO:K06514]
      3685 (ITGAV)
  Others
   PECAM1, CD31; platelet/endothelial cell adhesion molecule [KO:K06471]
    VNR Cell adhesion molecules (CAMs)
     3685 (ITGAV)
   ICAM4; intercellular adhesion molecule 4 [KO:K06581]
     3685 (ITGAV)
    alpha V beta 1 Cell adhesion molecules (CAMs)
     3685 (ITGAV)
    alpha V beta 5 Cell adhesion molecules (CAMs)
     3685 (ITGAV)
 7. Others
  SDC1; syndecan 1 [KO:K06257]
   VNR Cell adhesion molecules (CAMs)
    3685 (ITGAV)
   alpha V beta 5 Cell adhesion molecules (CAMs)
    3685 (ITGAV)
Cellular antigens [BR:hsa04090]
 Proteins
  3685 (ITGAV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q31-q32
AA seq 1048 aa AA seqDB search
MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccgccgcggcgacggctgcgcctcggtccccgcggcctcccgcttcttctc
tcgggactcctgctacctctgtgccgcgccttcaacctagacgtggacagtcctgccgag
tactctggccccgagggaagttacttcggcttcgccgtggatttcttcgtgcccagcgcg
tcttcccggatgtttcttctcgtgggagctcccaaagcaaacaccacccagcctgggatt
gtggaaggagggcaggtcctcaaatgtgactggtcttctacccgccggtgccagccaatt
gaatttgatgcaacaggcaatagagattatgccaaggatgatccattggaatttaagtcc
catcagtggtttggagcatctgtgaggtcgaaacaggataaaattttggcctgtgcccca
ttgtaccattggagaactgagatgaaacaggagcgagagcctgttggaacatgctttctt
caagatggaacaaagactgttgagtatgctccatgtagatcacaagatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagcttttattggcaaggtcagcttatttcggatcaagtggcagaa
atcgtatctaaatacgaccccaatgtttacagcatcaagtataataaccaattagcaact
cggactgcacaagctatttttgatgacagctatttgggttattctgtggctgtcggagat
ttcaatggtgatggcatagatgactttgtttcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaagaacatgtcctccttatacaattttactggcgag
cagatggctgcatatttcggattttctgtagctgccactgacattaatggagatgattat
gcagatgtgtttattggagcacctctcttcatggatcgtggctctgatggcaaactccaa
gaggtggggcaggtctcagtgtctctacagagagcttcaggagacttccagacgacaaag
ctgaatggatttgaggtctttgcacggtttggcagtgccatagctcctttgggagatctg
gaccaggatggtttcaatgatattgcaattgctgctccatatgggggtgaagataaaaaa
ggaattgtttatatcttcaatggaagatcaacaggcttgaacgcagtcccatctcaaatc
cttgaagggcagtgggctgctcgaagcatgccaccaagctttggctattcaatgaaagga
gccacagatatagacaaaaatggatatccagacttaattgtaggagcttttggtgtagat
cgagctatcttatacagggccagaccagttatcactgtaaatgctggtcttgaagtgtac
cctagcattttaaatcaagacaataaaacctgctcactgcctggaacagctctcaaagtt
tcctgttttaatgttaggttctgcttaaaggcagatggcaaaggagtacttcccaggaaa
cttaatttccaggtggaacttcttttggataaactcaagcaaaagggagcaattcgacga
gcactgtttctctacagcaggtccccaagtcactccaagaacatgactatttcaaggggg
ggactgatgcagtgtgaggaattgatagcgtatctgcgggatgaatctgaatttagagac
aaactcactccaattactatttttatggaatatcggttggattatagaacagctgctgat
acaacaggcttgcaacccattcttaaccagttcacgcctgctaacattagtcgacaggct
cacattctacttgactgtggtgaagacaatgtctgtaaacccaagctggaagtttctgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgacattgattgttaag
gctcagaatcaaggagaaggtgcctacgaagctgagctcatcgtttccattccactgcag
gctgatttcatcggggttgtccgaaacaatgaagccttagcaagactttcctgtgcattt
aagacagaaaaccaaactcgccaggtggtatgtgaccttggaaacccaatgaaggctgga
actcaactcttagctggtcttcgtttcagtgtgcaccagcagtcagagatggatacttct
gtgaaatttgacttacaaatccaaagctcaaatctatttgacaaagtaagcccagttgta
tctcacaaagttgatcttgctgttttagctgcagttgagataagaggagtctcgagtcct
gatcatatctttcttccgattccaaactgggagcacaaggagaaccctgagactgaagaa
gatgttgggccagttgttcagcacatctatgagctgagaaacaatggtccaagttcattc
agcaaggcaatgctccatcttcagtggccttacaaatataataataacactctgttgtat
atccttcattatgatattgatggaccaatgaactgcacttcagatatggagatcaaccct
ttgagaattaagatctcatctttgcaaacaactgaaaagaatgacacggttgccgggcaa
ggtgagcgggaccatctcatcactaagcgggatcttgccctcagtgaaggagatattcac
actttgggttgtggagttgctcagtgcttgaagattgtctgccaagttgggagattagac
agaggaaagagtgcaatcttgtacgtaaagtcattactgtggactgagacttttatgaat
aaagaaaatcagaatcattcctattctctgaagtcgtctgcttcatttaatgtcatagag
tttccttataagaatcttccaattgaggatatcaccaactccacattggttaccactaat
gtcacctggggcattcagccagcgcccatgcctgtgcctgtgtgggtgatcattttagca
gttctagcaggattgttgctactggctgttttggtatttgtaatgtacaggatgggcttt
tttaaacgggtccggccacctcaagaagaacaagaaagggagcagcttcaacctcatgaa
aatggtgaaggaaactcagaaacttaa

DBGET integrated database retrieval system