KEGG   Homo sapiens (human): 3687Help
Entry
3687              CDS       T01001                                 

Gene name
ITGAX, CD11C, SLEB6
Definition
(RefSeq) integrin, alpha X (complement component 3 receptor 4 subunit)
  KO
K06462  
integrin alpha X
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3687 (ITGAX)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    3687 (ITGAX)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    3687 (ITGAX)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Others
   ICAM4; intercellular adhesion molecule 4 [KO:K06581]
    p150/95 Cell adhesion molecules (CAMs)
     3687 (ITGAX)
Cellular antigens [BR:hsa04090]
 Proteins
  3687 (ITGAX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 1163 aa AA seqDB search
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAA
NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNM
YLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQ
FQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLF
HASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDK
RSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLP
SCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDN
LGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ
LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL
DCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEM
MEEANGQIAPENGTQTPSPPSEK
NT seq 3492 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggaccagggcagcactcctcctgttcacagccttagcaacttctctaggtttc
aacttggacacagaggagctgacagccttccgtgtggacagcgctgggtttggagacagc
gtggtccagtatgccaactcctgggtggtggttggagccccccaaaagataacagctgcc
aaccaaacgggtggcctctaccagtgtggctacagcactggtgcctgtgagcccatcggc
ctgcaggtgcccccggaggccgtgaacatgtccctgggcctgtccctggcgtctaccacc
agcccttcccagctgctggcctgcggccccaccgtgcaccacgagtgcgggaggaacatg
tacctcaccggactctgcttcctcctgggccccacccagctcacccagaggctcccggtg
tccaggcaggagtgcccaagacaggagcaggacattgtgttcctgatcgatggctcaggc
agcatctcctcccgcaactttgccacgatgatgaacttcgtgagagctgtgataagccag
ttccagagacccagcacccagttttccctgatgcagttctccaacaaattccaaacacac
ttcactttcgaggaattcaggcgcagctcaaaccccctcagcctgttggcttctgttcac
cagctgcaagggtttacatacacggccaccgccatccaaaatgtcgtgcaccgattgttc
catgcctcatatggggcccgtagggatgccgccaaaattctcattgtcatcactgatggg
aagaaagaaggcgacagcctggattataaggatgtcatccccatggctgatgcagcaggc
atcatccgctatgcaattggggttggattagcttttcaaaacagaaattcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaagatattcaaaaccaactgaaggagaagatctttgccattgagggtacggag
accacaagcagtagctccttcgaattggagatggcacaggagggcttcagcgctgtgttc
acacctgatggccccgttctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtaccccccaaatatgagccctaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccaccgagctggccctctggaaaggggtgcagagcctg
gtcctgggggccccccgctaccagcacaccgggaaggctgtcatcttcacccaggtgtcc
aggcaatggaggatgaaggccgaagtcacggggactcagatcggctcctacttcggggcc
tccctctgctccgtggacgtagacagcgacggcagcaccgacctggtcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtctgtgtgtcccttgcccaggggg
tggagaaggtggtggtgtgatgctgttctctacggggagcagggccacccctggggtcgc
tttggggcggctctgacagtgctgggggatgtgaatggggacaagctgacagacgtggtc
atcggggccccaggagaggaggagaaccggggtgctgtctacctgtttcacggagtcttg
ggacccagcatcagcccctcccacagccagcggatcgcgggctcccagctctcctccagg
ctgcagtattttgggcaggcactgagcgggggtcaagacctcacccaggatggactggtg
gacctggctgtgggggcccggggccaggtgctcctgctcaggaccagacctgtgctctgg
gtgggggtgagcatgcagttcatacctgccgagatccccaggtctgcgtttgagtgtcgg
gagcaggtggtctctgagcagaccctggtacagtccaacatctgcctttacattgacaaa
cgttctaagaacctgcttgggagccgtgacctccaaagctctgtgaccttggacctggcc
ctcgaccctggccgcctgagtccccgtgccaccttccaggaaacaaagaaccggagtctg
agccgagtccgagtcctcgggctgaaggcacactgtgaaaacttcaacctgctgctcccg
agctgcgtggaggactctgtgacccccattaccttgcgtctgaacttcacgctggtgggc
aagcccctccttgccttcagaaacctgcggcctatgctggccgccgatgctcagagatac
ttcacggcctccctaccctttgagaagaactgtggagccgaccatatctgccaggacaat
ctcggcatctccttcagcttcccaggcttgaagtccctgctggtggggagtaacctggag
ctgaacgcagaagtgatggtgtggaatgacggggaagactcctacggaaccaccatcacc
ttctcccaccccgcaggactgtcctaccgctacgtggcagagggccagaaacaagggcag
ctgcgttccctgcacctgacatgtgacagcgccccagttgggagccagggcacctggagc
accagctgcagaatcaaccacctcatcttccgtggcggcgcccagatcaccttcttggct
acctttgacgtctcccccaaggctgtcctgggagaccggctgcttctgacagccaatgtg
agcagtgagaacaacactcccaggaccagcaagaccaccttccagctggagctcccggtg
aagtatgctgtctacactgtggttagcagccacgaacaattcaccaaatacctcaacttc
tcagagtctgaggagaaggaaagccatgtggccatgcacagataccaggtcaataacctg
ggacagagggacctgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggatgtggaggtctcccacccccagaacccatcccttcggtgctcctca
gagaaaatcgcacccccagcatctgacttcctggcgcacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccgctgtgacgtcccctccttcagcgtccag
gaggagctggatttcaccctgaagggcaacctcagctttggctgggtccgccagatattg
cagaagaaggtgtcggtcgtgagtgtggctgaaattacgttcgacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacgacaacggtgctggagaagtac
aaggtccacaaccccacccccctcatcgtaggcagctccattgggggtctgttgctgctg
gcactcatcacagcggtactgtacaaagttggcttcttcaagcgtcagtacaaggaaatg
atggaggaggcaaatggacaaattgccccagaaaacgggacacagacccccagcccgccc
agtgagaaatga

DBGET integrated database retrieval system