KEGG   Homo sapiens (human): 3687Help
Entry
3687              CDS       T01001                                 

Gene name
ITGAX, CD11C, SLEB6
Definition
integrin, alpha X (complement component 3 receptor 4 subunit)
Orthology
K06462  
integrin alpha X
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3687 (ITGAX)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    3687 (ITGAX)
Cellular antigens [BR:hsa04090]
 Proteins
  3687 (ITGAX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 1163 aa AA seqDB search
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAA
NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNM
YLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQ
FQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLF
HASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDK
RSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLP
SCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDN
LGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ
LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL
DCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEM
MEEANGQIAPENGTQTPSPPSEK
NT seq 3492 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggaccagggcagcactcctcctgttcacagccttagcaacttctctaggtttc
aacttggacacagaggagctgacagccttccgtgtggacagcgctgggtttggagacagc
gtggtccagtatgccaactcctgggtggtggttggagccccccaaaagataacagctgcc
aaccaaacgggtggcctctaccagtgtggctacagcactggtgcctgtgagcccatcggc
ctgcaggtgcccccggaggccgtgaacatgtccctgggcctgtccctggcgtctaccacc
agcccttcccagctgctggcctgcggccccaccgtgcaccacgagtgcgggaggaacatg
tacctcaccggactctgcttcctcctgggccccacccagctcacccagaggctcccggtg
tccaggcaggagtgcccaagacaggagcaggacattgtgttcctgatcgatggctcaggc
agcatctcctcccgcaactttgccacgatgatgaacttcgtgagagctgtgataagccag
ttccagagacccagcacccagttttccctgatgcagttctccaacaaattccaaacacac
ttcactttcgaggaattcaggcgcagctcaaaccccctcagcctgttggcttctgttcac
cagctgcaagggtttacatacacggccaccgccatccaaaatgtcgtgcaccgattgttc
catgcctcatatggggcccgtagggatgccgccaaaattctcattgtcatcactgatggg
aagaaagaaggcgacagcctggattataaggatgtcatccccatggctgatgcagcaggc
atcatccgctatgcaattggggttggattagcttttcaaaacagaaattcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaagatattcaaaaccaactgaaggagaagatctttgccattgagggtacggag
accacaagcagtagctccttcgaattggagatggcacaggagggcttcagcgctgtgttc
acacctgatggccccgttctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtaccccccaaatatgagccctaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccaccgagctggccctctggaaaggggtgcagagcctg
gtcctgggggccccccgctaccagcacaccgggaaggctgtcatcttcacccaggtgtcc
aggcaatggaggatgaaggccgaagtcacggggactcagatcggctcctacttcggggcc
tccctctgctccgtggacgtagacagcgacggcagcaccgacctggtcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtctgtgtgtcccttgcccaggggg
tggagaaggtggtggtgtgatgctgttctctacggggagcagggccacccctggggtcgc
tttggggcggctctgacagtgctgggggatgtgaatggggacaagctgacagacgtggtc
atcggggccccaggagaggaggagaaccggggtgctgtctacctgtttcacggagtcttg
ggacccagcatcagcccctcccacagccagcggatcgcgggctcccagctctcctccagg
ctgcagtattttgggcaggcactgagcgggggtcaagacctcacccaggatggactggtg
gacctggctgtgggggcccggggccaggtgctcctgctcaggaccagacctgtgctctgg
gtgggggtgagcatgcagttcatacctgccgagatccccaggtctgcgtttgagtgtcgg
gagcaggtggtctctgagcagaccctggtacagtccaacatctgcctttacattgacaaa
cgttctaagaacctgcttgggagccgtgacctccaaagctctgtgaccttggacctggcc
ctcgaccctggccgcctgagtccccgtgccaccttccaggaaacaaagaaccggagtctg
agccgagtccgagtcctcgggctgaaggcacactgtgaaaacttcaacctgctgctcccg
agctgcgtggaggactctgtgacccccattaccttgcgtctgaacttcacgctggtgggc
aagcccctccttgccttcagaaacctgcggcctatgctggccgccgatgctcagagatac
ttcacggcctccctaccctttgagaagaactgtggagccgaccatatctgccaggacaat
ctcggcatctccttcagcttcccaggcttgaagtccctgctggtggggagtaacctggag
ctgaacgcagaagtgatggtgtggaatgacggggaagactcctacggaaccaccatcacc
ttctcccaccccgcaggactgtcctaccgctacgtggcagagggccagaaacaagggcag
ctgcgttccctgcacctgacatgtgacagcgccccagttgggagccagggcacctggagc
accagctgcagaatcaaccacctcatcttccgtggcggcgcccagatcaccttcttggct
acctttgacgtctcccccaaggctgtcctgggagaccggctgcttctgacagccaatgtg
agcagtgagaacaacactcccaggaccagcaagaccaccttccagctggagctcccggtg
aagtatgctgtctacactgtggttagcagccacgaacaattcaccaaatacctcaacttc
tcagagtctgaggagaaggaaagccatgtggccatgcacagataccaggtcaataacctg
ggacagagggacctgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggatgtggaggtctcccacccccagaacccatcccttcggtgctcctca
gagaaaatcgcacccccagcatctgacttcctggcgcacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccgctgtgacgtcccctccttcagcgtccag
gaggagctggatttcaccctgaagggcaacctcagctttggctgggtccgccagatattg
cagaagaaggtgtcggtcgtgagtgtggctgaaattacgttcgacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacgacaacggtgctggagaagtac
aaggtccacaaccccacccccctcatcgtaggcagctccattgggggtctgttgctgctg
gcactcatcacagcggtactgtacaaagttggcttcttcaagcgtcagtacaaggaaatg
atggaggaggcaaatggacaaattgccccagaaaacgggacacagacccccagcccgccc
agtgagaaatga

DBGET integrated database retrieval system