KEGG   Homo sapiens (human): 3688Help
Entry
3688              CDS       T01001                                 

Gene name
ITGB1, CD29, FNRB, GPIIA, MDF2, MSK12, VLA-BETA, VLAB
Definition
integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
Orthology
K05719  
integrin beta 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Phagosome
PI3K-Akt signaling pathway
Axon guidance
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Pertussis
Leishmaniasis
Toxoplasmosis
Pathways in cancer
Proteoglycans in cancer
Small cell lung cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p11.2
AA seq 798 aa AA seqDB search
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaaccaattttctggattggactgatcagttcagtttgctgtgtgtttgct
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtgggtggtgcacaaattcaacatttttacaggaaggaatgcctact
tctgcacgatgtgatgatttagaagccttaaaaaagaagggttgccctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacattaaaattcaagagagctgaagac
tatcccattgacctctactaccttatggacctgtcttactcaatgaaagacgatttggag
aatgtaaaaagtcttggaacagatctgatgaatgaaatgaggaggattacttcggacttc
agaattggatttggctcatttgtggaaaagactgtgatgccttacattagcacaacacca
gctaagctcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgctcagtcttactaataaaggagaagtatttaatgaacttgttggaaaacagcgc
atatctggaaatttggattctccagaaggtggtttcgatgccatcatgcaagttgcagtt
tgtggatcactgattggctggaggaatgttacacggctgctggtgttttccacagatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacaa
tgtcacctggaaaataatatgtacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactgagtgaaaataatattcagacaatttttgcagttactgaagaa
tttcagcctgtttacaaggagctgaaaaacttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaatgtaattcagttgatcattgatgcatacaattccctttcctca
gaagtcattttggaaaacggcaaattgtcagaaggcgtaacaataagttacaaatcttac
tgcaagaacggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataagtgtccaaaaaaggattct
gacagctttaaaattaggcctctgggctttacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgccaaagcgaaggcatccctgaaagtcccaagtgtcatgaagga
aatgggacatttgagtgtggcgcgtgcaggtgcaatgaagggcgtgttggtagacattgt
gaatgcagcacagatgaagttaacagtgaagacatggatgcttactgcaggaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcgtctgcggacagtgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaaccccaactacactggcagtgcatgtgactgttctttggatactagtacttgtgaa
gccagcaacggacagatctgcaatggccggggcatctgcgagtgtggtgtctgtaagtgt
acagatccgaagtttcaagggcaaacgtgtgagatgtgtcagacctgccttggtgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgcacacaggaatgttcctattttaacattaccaaggtagaaagtcgggacaaattaccc
cagccggtccaacctgatcctgtgtcccattgtaaggagaaggatgttgacgactgttgg
ttctattttacgtattcagtgaatgggaacaacgaggtcatggttcatgttgtggagaat
ccagagtgtcccactggtccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgataattcatgacaga
agggagtttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgccgtaacaactgtggtcaatccgaagtatgagggaaaatga

DBGET integrated database retrieval system