KEGG   Homo sapiens (human): 3688Help
Entry
3688              CDS       T01001                                 

Gene name
ITGB1, CD29, FNRB, GPIIA, MDF2, MSK12, VLA-BETA, VLAB
Definition
integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
Orthology
K05719  
integrin beta 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Phagosome
PI3K-Akt signaling pathway
Axon guidance
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Platelet activation
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Pertussis
Leishmaniasis
Toxoplasmosis
Pathways in cancer
Proteoglycans in cancer
Small cell lung cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    3688 (ITGB1)
   04151 PI3K-Akt signaling pathway
    3688 (ITGB1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3688 (ITGB1)
   04514 Cell adhesion molecules (CAMs)
    3688 (ITGB1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3688 (ITGB1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3688 (ITGB1)
  Cellular commiunity
   04510 Focal adhesion
    3688 (ITGB1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    3688 (ITGB1)
   04670 Leukocyte transendothelial migration
    3688 (ITGB1)
  Development
   04360 Axon guidance
    3688 (ITGB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3688 (ITGB1)
   05205 Proteoglycans in cancer
    3688 (ITGB1)
   05222 Small cell lung cancer
    3688 (ITGB1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3688 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3688 (ITGB1)
   05414 Dilated cardiomyopathy (DCM)
    3688 (ITGB1)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    3688 (ITGB1)
   05131 Shigellosis
    3688 (ITGB1)
   05133 Pertussis
    3688 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    3688 (ITGB1)
   05145 Toxoplasmosis
    3688 (ITGB1)
   05140 Leishmaniasis
    3688 (ITGB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3688 (ITGB1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    NRCAM; neuronal cell adhesion molecule [KO:K06756]
     VLA-4 Cell adhesion molecules (CAMs)
      3688 (ITGB1)
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     VLA-5 Cell adhesion molecules (CAMs)
      3688 (ITGB1)
 2. Integrin Family
  Beta1 integrins
   VLA-2
    ITGB1; integrin beta 1 [KO:K05719]
     VLA-3 Cell adhesion molecules (CAMs)
      3688 (ITGB1)
   VLA-3
     VLA-2 Cell adhesion molecules (CAMs)
      3688 (ITGB1)
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type I classic cadherins
    CDHE, CDH1; cadherin 1, type 1, E-cadherin [KO:K05689]
     VLA-2 Cell adhesion molecules (CAMs)
      3688 (ITGB1)
Cellular antigens [BR:hsa04090]
 Proteins
  3688 (ITGB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p11.2
AA seq 798 aa AA seqDB search
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaaccaattttctggattggactgatcagttcagtttgctgtgtgtttgct
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtgggtggtgcacaaattcaacatttttacaggaaggaatgcctact
tctgcacgatgtgatgatttagaagccttaaaaaagaagggttgccctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacattaaaattcaagagagctgaagac
tatcccattgacctctactaccttatggacctgtcttactcaatgaaagacgatttggag
aatgtaaaaagtcttggaacagatctgatgaatgaaatgaggaggattacttcggacttc
agaattggatttggctcatttgtggaaaagactgtgatgccttacattagcacaacacca
gctaagctcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgctcagtcttactaataaaggagaagtatttaatgaacttgttggaaaacagcgc
atatctggaaatttggattctccagaaggtggtttcgatgccatcatgcaagttgcagtt
tgtggatcactgattggctggaggaatgttacacggctgctggtgttttccacagatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacaa
tgtcacctggaaaataatatgtacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactgagtgaaaataatattcagacaatttttgcagttactgaagaa
tttcagcctgtttacaaggagctgaaaaacttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaatgtaattcagttgatcattgatgcatacaattccctttcctca
gaagtcattttggaaaacggcaaattgtcagaaggcgtaacaataagttacaaatcttac
tgcaagaacggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataagtgtccaaaaaaggattct
gacagctttaaaattaggcctctgggctttacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgccaaagcgaaggcatccctgaaagtcccaagtgtcatgaagga
aatgggacatttgagtgtggcgcgtgcaggtgcaatgaagggcgtgttggtagacattgt
gaatgcagcacagatgaagttaacagtgaagacatggatgcttactgcaggaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcgtctgcggacagtgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaaccccaactacactggcagtgcatgtgactgttctttggatactagtacttgtgaa
gccagcaacggacagatctgcaatggccggggcatctgcgagtgtggtgtctgtaagtgt
acagatccgaagtttcaagggcaaacgtgtgagatgtgtcagacctgccttggtgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgcacacaggaatgttcctattttaacattaccaaggtagaaagtcgggacaaattaccc
cagccggtccaacctgatcctgtgtcccattgtaaggagaaggatgttgacgactgttgg
ttctattttacgtattcagtgaatgggaacaacgaggtcatggttcatgttgtggagaat
ccagagtgtcccactggtccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgataattcatgacaga
agggagtttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgccgtaacaactgtggtcaatccgaagtatgagggaaaatga

DBGET integrated database retrieval system