KEGG   Homo sapiens (human): 3689Help
Entry
3689              CDS       T01001                                 

Gene name
ITGB2, CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7
Definition
(RefSeq) integrin subunit beta 2
  KO
K06464  integrin beta 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04390  Hippo signaling pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04610  Complement and coagulation cascades
hsa04650  Natural killer cell mediated cytotoxicity
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05166  HTLV-I infection
hsa05323  Rheumatoid arthritis
hsa05416  Viral myocarditis
Disease
H00099  Leukocyte adhesion deficiency (LAD)
Drug target
Erlizumab: D04045
Rovelizumab: D08993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    3689 (ITGB2)
   04390 Hippo signaling pathway
    3689 (ITGB2)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3689 (ITGB2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3689 (ITGB2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3689 (ITGB2)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    3689 (ITGB2)
   04650 Natural killer cell mediated cytotoxicity
    3689 (ITGB2)
   04670 Leukocyte transendothelial migration
    3689 (ITGB2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    3689 (ITGB2)
  Cardiovascular diseases
   05416 Viral myocarditis
    3689 (ITGB2)
  Infectious diseases
   05133 Pertussis
    3689 (ITGB2)
   05134 Legionellosis
    3689 (ITGB2)
   05150 Staphylococcus aureus infection
    3689 (ITGB2)
   05152 Tuberculosis
    3689 (ITGB2)
   05166 HTLV-I infection
    3689 (ITGB2)
   05146 Amoebiasis
    3689 (ITGB2)
   05144 Malaria
    3689 (ITGB2)
   05140 Leishmaniasis
    3689 (ITGB2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3689 (ITGB2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3689 (ITGB2)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3689 (ITGB2)
CD molecules [BR:hsa04090]
 Proteins
  3689 (ITGB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2
Motif
Other DBs
NCBI-GeneID: 3689
NCBI-ProteinID: NP_000202
OMIM: 600065
HGNC: 6155
Ensembl: ENSG00000160255
Vega: OTTHUMG00000090257
Pharos: P05107(Tclin)
UniProt: P05107
Structure
PDB: 

Jmol
Position
21q22.3
AA seq 769 aa AA seqDB search
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAY
NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN
CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTIN
CERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGR
TCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL
VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcctgcgccccccactgctcgccctggtggggctgctctccctcgggtgcgtc
ctctctcaggagtgcacgaagttcaaggtcagcagctgccgggaatgcatcgagtcgggg
cccggctgcacctggtgccagaagctgaacttcacagggccgggggatcctgactccatt
cgctgcgacacccggccacagctgctcatgaggggctgtgcggctgacgacatcatggac
cccacaagcctcgctgaaacccaggaagaccacaatgggggccagaagcagctgtcccca
caaaaagtgacgctttacctgcgaccaggccaggcagcagcgttcaacgtgaccttccgg
cgggccaagggctaccccatcgacctgtactatctgatggacctctcctactccatgctt
gatgacctcaggaatgtcaagaagctaggtggcgacctgctccgggccctcaacgagatc
accgagtccggccgcattggcttcgggtccttcgtggacaagaccgtgctgccgttcgtg
aacacgcaccctgataagctgcgaaacccatgccccaacaaggagaaagagtgccagccc
ccgtttgccttcaggcacgtgctgaagctgaccaacaactccaaccagtttcagaccgag
gtcgggaagcagctgatttccggaaacctggatgcacccgagggtgggctggacgccatg
atgcaggtcgccgcctgcccggaggaaatcggctggcgcaacgtcacgcggctgctggtg
tttgccactgatgacggcttccatttcgcgggcgacgggaagctgggcgccatcctgacc
cccaacgacggccgctgtcacctggaggacaacttgtacaagaggagcaacgaattcgac
tacccatcggtgggccagctggcgcacaagctggctgaaaacaacatccagcccatcttc
gcggtgaccagtaggatggtgaagacctacgagaaactcaccgagatcatccccaagtca
gccgtgggggagctgtctgaggactccagcaatgtggtccatctcattaagaatgcttac
aataaactctcctccagggtcttcctggatcacaacgccctccccgacaccctgaaagtc
acctacgactccttctgcagcaatggagtgacgcacaggaaccagcccagaggtgactgt
gatggcgtgcagatcaatgtcccgatcaccttccaggtgaaggtcacggccacagagtgc
atccaggagcagtcgtttgtcatccgggcgctgggcttcacggacatagtgaccgtgcag
gttcttccccagtgtgagtgccggtgccgggaccagagcagagaccgcagcctctgccat
ggcaagggcttcttggagtgcggcatctgcaggtgtgacactggctacattgggaaaaac
tgtgagtgccagacacagggccggagcagccaggagctggaaggaagctgccggaaggac
aacaactccatcatctgctcagggctgggggactgtgtctgcgggcagtgcctgtgccac
accagcgacgtccccggcaagctgatatacgggcagtactgcgagtgtgacaccatcaac
tgtgagcgctacaacggccaggtctgcggcggcccggggagggggctctgcttctgcggg
aagtgccgctgccacccgggctttgagggctcagcgtgccagtgcgagaggaccactgag
ggctgcctgaacccgcggcgtgttgagtgtagtggtcgtggccggtgccgctgcaacgta
tgcgagtgccattcaggctaccagctgcctctgtgccaggagtgccccggctgcccctca
ccctgtggcaagtacatctcctgcgccgagtgcctgaagttcgaaaagggcccctttggg
aagaactgcagcgcggcgtgtccgggcctgcagctgtcgaacaaccccgtgaagggcagg
acctgcaaggagagggactcagagggctgctgggtggcctacacgctggagcagcaggac
gggatggaccgctacctcatctatgtggatgagagccgagagtgtgtggcaggccccaac
atcgccgccatcgtcgggggcaccgtggcaggcatcgtgctgatcggcattctcctgctg
gtcatctggaaggctctgatccacctgagcgacctccgggagtacaggcgctttgagaag
gagaagctcaagtcccagtggaacaatgataatccccttttcaagagcgccaccacgacg
gtcatgaaccccaagtttgctgagagttag

DBGET integrated database retrieval system