KEGG   Homo sapiens (human): 3689Help
Entry
3689              CDS       T01001                                 

Gene name
ITGB2, CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7
Definition
integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Orthology
K06464  
integrin beta 2
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Phagosome
Hippo signaling pathway
Cell adhesion molecules (CAMs)
Natural killer cell mediated cytotoxicity
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Pertussis
Legionellosis
Leishmaniasis
Malaria
Amoebiasis
Staphylococcus aureus infection
Tuberculosis
HTLV-I infection
Rheumatoid arthritis
Viral myocarditis
Disease
H00099  
Leukocyte adhesion deficiency (LAD)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    3689 (ITGB2)
   04390 Hippo signaling pathway
    3689 (ITGB2)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3689 (ITGB2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3689 (ITGB2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3689 (ITGB2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3689 (ITGB2)
   04670 Leukocyte transendothelial migration
    3689 (ITGB2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    3689 (ITGB2)
  Cardiovascular diseases
   05416 Viral myocarditis
    3689 (ITGB2)
  Infectious diseases
   05133 Pertussis
    3689 (ITGB2)
   05134 Legionellosis
    3689 (ITGB2)
   05150 Staphylococcus aureus infection
    3689 (ITGB2)
   05152 Tuberculosis
    3689 (ITGB2)
   05166 HTLV-I infection
    3689 (ITGB2)
   05146 Amoebiasis
    3689 (ITGB2)
   05144 Malaria
    3689 (ITGB2)
   05140 Leishmaniasis
    3689 (ITGB2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3689 (ITGB2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   ICAM family
    ICAM1; intercellular adhesion molecule 1 [KO:K06490]
     LFA-1 Cell adhesion molecules (CAMs)
      3689 (ITGB2)
     CR3, Mac-1 Cell adhesion molecules (CAMs)
      3689 (ITGB2)
    ICAM2; intercellular adhesion molecule 2 [KO:K06523]
     LFA-1 Cell adhesion molecules (CAMs)
      3689 (ITGB2)
    ICAM3; intercellular adhesion molecule 3 [KO:K06486]
     LFA-1 Cell adhesion molecules (CAMs)
      3689 (ITGB2)
     alpha D beta 2 Cell adhesion molecules (CAMs)
      3689 (ITGB2)
   Others
    CD226, DNAM1; CD226 antigen [KO:K06567]
     LFA-1 Cell adhesion molecules (CAMs)
      3689 (ITGB2)
  Neural system
   N/0 subfamily
    ICAM5, TLCN; intercellular adhesion molecule 5 [KO:K06769]
      3689 (ITGB2)
    THY1, CD90; Thy-1 cell surface antigen [KO:K06514]
     CR3, Mac-1 Cell adhesion molecules (CAMs)
      3689 (ITGB2)
Cellular antigens [BR:hsa04090]
 Proteins
  3689 (ITGB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.3
AA seq 769 aa AA seqDB search
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAY
NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN
CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTIN
CERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGR
TCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL
VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcctgcgccccccactgctcgccctggtggggctgctctccctcgggtgcgtc
ctctctcaggagtgcacgaagttcaaggtcagcagctgccgggaatgcatcgagtcgggg
cccggctgcacctggtgccagaagctgaacttcacagggccgggggatcctgactccatt
cgctgcgacacccggccacagctgctcatgaggggctgtgcggctgacgacatcatggac
cccacaagcctcgctgaaacccaggaagaccacaatgggggccagaagcagctgtcccca
caaaaagtgacgctttacctgcgaccaggccaggcagcagcgttcaacgtgaccttccgg
cgggccaagggctaccccatcgacctgtactatctgatggacctctcctactccatgctt
gatgacctcaggaatgtcaagaagctaggtggcgacctgctccgggccctcaacgagatc
accgagtccggccgcattggcttcgggtccttcgtggacaagaccgtgctgccgttcgtg
aacacgcaccctgataagctgcgaaacccatgccccaacaaggagaaagagtgccagccc
ccgtttgccttcaggcacgtgctgaagctgaccaacaactccaaccagtttcagaccgag
gtcgggaagcagctgatttccggaaacctggatgcacccgagggtgggctggacgccatg
atgcaggtcgccgcctgcccggaggaaatcggctggcgcaacgtcacgcggctgctggtg
tttgccactgatgacggcttccatttcgcgggcgacgggaagctgggcgccatcctgacc
cccaacgacggccgctgtcacctggaggacaacttgtacaagaggagcaacgaattcgac
tacccatcggtgggccagctggcgcacaagctggctgaaaacaacatccagcccatcttc
gcggtgaccagtaggatggtgaagacctacgagaaactcaccgagatcatccccaagtca
gccgtgggggagctgtctgaggactccagcaatgtggtccaactcattaagaatgcttac
aataaactctcctccagggtcttcctggatcacaacgccctccccgacaccctgaaagtc
acctacgactccttctgcagcaatggagtgacgcacaggaaccagcccagaggtgactgt
gatggcgtgcagatcaatgtcccgatcaccttccaggtgaaggtcacggccacagagtgc
atccaggagcagtcgtttgtcatccgggcgctgggcttcacggacatagtgaccgtgcag
gttcttccccagtgtgagtgccggtgccgggaccagagcagagaccgcagcctctgccat
ggcaagggcttcttggagtgcggcatctgcaggtgtgacactggctacattgggaaaaac
tgtgagtgccagacacagggccggagcagccaggagctggaaggaagctgccggaaggac
aacaactccatcatctgctcagggctgggggactgtgtctgcgggcagtgcctgtgccac
accagcgacgtccccggcaagctgatatacgggcagtactgcgagtgtgacaccatcaac
tgtgagcgctacaacggccaggtctgcggcggcccggggagggggctctgcttctgcggg
aagtgccgctgccacccgggctttgagggctcagcgtgccagtgcgagaggaccactgag
ggctgcctgaacccgcggcgtgttgagtgtagtggtcgtggccggtgccgctgcaacgta
tgcgagtgccattcaggctaccagctgcctctgtgccaggagtgccccggctgcccctca
ccctgtggcaagtacatctcctgcgccgagtgcctgaagttcgaaaagggcccctttggg
aagaactgcagcgcggcgtgtccgggcctgcagctgtcgaacaaccccgtgaagggcagg
acctgcaaggagagggactcagagggctgctgggtggcctacacgctggagcagcaggac
gggatggaccgctacctcatctatgtggatgagagccgagagtgtgtggcaggccccaac
atcgccgccatcgtcgggggcaccgtggcaggcatcgtgctgatcggcattctcctgctg
gtcatctggaaggctctgatccacctgagcgacctccgggagtacaggcgctttgagaag
gagaagctcaagtcccagtggaacaatgataatccccttttcaagagcgccaccacgacg
gtcatgaaccccaagtttgctgagagttag

DBGET integrated database retrieval system