KEGG   Homo sapiens (human): 3689Help
Entry
3689              CDS       T01001                                 

Gene name
ITGB2, CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7
Definition
integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Orthology
K06464  
integrin beta 2
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Phagosome
Hippo signaling pathway
Cell adhesion molecules (CAMs)
Natural killer cell mediated cytotoxicity
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Pertussis
Legionellosis
Leishmaniasis
Malaria
Amoebiasis
Staphylococcus aureus infection
Tuberculosis
HTLV-I infection
Rheumatoid arthritis
Viral myocarditis
Disease
H00099  
Leukocyte adhesion deficiency (LAD)
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.3
AA seq 769 aa AA seqDB search
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAY
NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN
CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTIN
CERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGR
TCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL
VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcctgcgccccccactgctcgccctggtggggctgctctccctcgggtgcgtc
ctctctcaggagtgcacgaagttcaaggtcagcagctgccgggaatgcatcgagtcgggg
cccggctgcacctggtgccagaagctgaacttcacagggccgggggatcctgactccatt
cgctgcgacacccggccacagctgctcatgaggggctgtgcggctgacgacatcatggac
cccacaagcctcgctgaaacccaggaagaccacaatgggggccagaagcagctgtcccca
caaaaagtgacgctttacctgcgaccaggccaggcagcagcgttcaacgtgaccttccgg
cgggccaagggctaccccatcgacctgtactatctgatggacctctcctactccatgctt
gatgacctcaggaatgtcaagaagctaggtggcgacctgctccgggccctcaacgagatc
accgagtccggccgcattggcttcgggtccttcgtggacaagaccgtgctgccgttcgtg
aacacgcaccctgataagctgcgaaacccatgccccaacaaggagaaagagtgccagccc
ccgtttgccttcaggcacgtgctgaagctgaccaacaactccaaccagtttcagaccgag
gtcgggaagcagctgatttccggaaacctggatgcacccgagggtgggctggacgccatg
atgcaggtcgccgcctgcccggaggaaatcggctggcgcaacgtcacgcggctgctggtg
tttgccactgatgacggcttccatttcgcgggcgacgggaagctgggcgccatcctgacc
cccaacgacggccgctgtcacctggaggacaacttgtacaagaggagcaacgaattcgac
tacccatcggtgggccagctggcgcacaagctggctgaaaacaacatccagcccatcttc
gcggtgaccagtaggatggtgaagacctacgagaaactcaccgagatcatccccaagtca
gccgtgggggagctgtctgaggactccagcaatgtggtccaactcattaagaatgcttac
aataaactctcctccagggtcttcctggatcacaacgccctccccgacaccctgaaagtc
acctacgactccttctgcagcaatggagtgacgcacaggaaccagcccagaggtgactgt
gatggcgtgcagatcaatgtcccgatcaccttccaggtgaaggtcacggccacagagtgc
atccaggagcagtcgtttgtcatccgggcgctgggcttcacggacatagtgaccgtgcag
gttcttccccagtgtgagtgccggtgccgggaccagagcagagaccgcagcctctgccat
ggcaagggcttcttggagtgcggcatctgcaggtgtgacactggctacattgggaaaaac
tgtgagtgccagacacagggccggagcagccaggagctggaaggaagctgccggaaggac
aacaactccatcatctgctcagggctgggggactgtgtctgcgggcagtgcctgtgccac
accagcgacgtccccggcaagctgatatacgggcagtactgcgagtgtgacaccatcaac
tgtgagcgctacaacggccaggtctgcggcggcccggggagggggctctgcttctgcggg
aagtgccgctgccacccgggctttgagggctcagcgtgccagtgcgagaggaccactgag
ggctgcctgaacccgcggcgtgttgagtgtagtggtcgtggccggtgccgctgcaacgta
tgcgagtgccattcaggctaccagctgcctctgtgccaggagtgccccggctgcccctca
ccctgtggcaagtacatctcctgcgccgagtgcctgaagttcgaaaagggcccctttggg
aagaactgcagcgcggcgtgtccgggcctgcagctgtcgaacaaccccgtgaagggcagg
acctgcaaggagagggactcagagggctgctgggtggcctacacgctggagcagcaggac
gggatggaccgctacctcatctatgtggatgagagccgagagtgtgtggcaggccccaac
atcgccgccatcgtcgggggcaccgtggcaggcatcgtgctgatcggcattctcctgctg
gtcatctggaaggctctgatccacctgagcgacctccgggagtacaggcgctttgagaag
gagaagctcaagtcccagtggaacaatgataatccccttttcaagagcgccaccacgacg
gtcatgaaccccaagtttgctgagagttag

DBGET integrated database retrieval system