KEGG   Homo sapiens (human): 3690Help
Entry
3690              CDS       T01001                                 

Gene name
ITGB3, BDPLT16, BDPLT2, CD61, GP3A, GPIIIa, GT
Definition
integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
Orthology
K06493  
integrin beta 3
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Phagosome
PI3K-Akt signaling pathway
Osteoclast differentiation
Focal adhesion
ECM-receptor interaction
Platelet activation
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Thyroid hormone signaling pathway
Proteoglycans in cancer
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Disease
H00083  
Allograft rejection
H00226  
Glanzmann thrombasthenia
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    3690 (ITGB3)
   04151 PI3K-Akt signaling pathway
    3690 (ITGB3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3690 (ITGB3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3690 (ITGB3)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3690 (ITGB3)
  Cellular commiunity
   04510 Focal adhesion
    3690 (ITGB3)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3690 (ITGB3)
   04611 Platelet activation
    3690 (ITGB3)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    3690 (ITGB3)
  Development
   04380 Osteoclast differentiation
    3690 (ITGB3)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    3690 (ITGB3)
   05205 Proteoglycans in cancer
    3690 (ITGB3)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3690 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3690 (ITGB3)
   05414 Dilated cardiomyopathy (DCM)
    3690 (ITGB3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3690 (ITGB3)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     VNR Cell adhesion molecules (CAMs)
      3690 (ITGB3)
   N/0 subfamily
    THY1, CD90; Thy-1 cell surface antigen [KO:K06514]
      3690 (ITGB3)
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type II classic cadherins
    CDH6; cadherin 6, type 2, K-cadherin [KO:K06798]
     alpha IIb  beta 3 Cell adhesion molecules (CAMs)
      3690 (ITGB3)
Cellular antigens [BR:hsa04090]
 Proteins
  3690 (ITGB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.32
AA seq 788 aa AA seqDB search
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgcggccgcggccccggccgctctgggcgactgtgctggcgctgggggcgctg
gcgggcgttggcgtaggagggcccaacatctgtaccacgcgaggtgtgagctcctgccag
cagtgcctggctgtgagccccatgtgtgcctggtgctctgatgaggccctgcctctgggc
tcacctcgctgtgacctgaaggagaatctgctgaaggataactgtgccccagaatccatc
gagttcccagtgagtgaggcccgagtactagaggacaggcccctcagcgacaagggctct
ggagacagctcccaggtcactcaagtcagtccccagaggattgcactccggctccggcca
gatgattcgaagaatttctccatccaagtgcggcaggtggaggattaccctgtggacatc
tactacttgatggacctgtcttactccatgaaggatgatctgtggagcatccagaacctg
ggtaccaagctggccacccagatgcgaaagctcaccagtaacctgcggattggcttcggg
gcatttgtggacaagcctgtgtcaccatacatgtatatctccccaccagaggccctcgaa
aacccctgctatgatatgaagaccacctgcttgcccatgtttggctacaaacacgtgctg
acgctaactgaccaggtgacccgcttcaatgaggaagtgaagaagcagagtgtgtcacgg
aaccgagatgccccagagggtggctttgatgccatcatgcaggctacagtctgtgatgaa
aagattggctggaggaatgatgcatcccacttgctggtgtttaccactgatgccaagact
catatagcattggacggaaggctggcaggcattgtccagcctaatgacgggcagtgtcat
gttggtagtgacaatcattactctgcctccactaccatggattatccctctttggggctg
atgactgagaagctatcccagaaaaacatcaatttgatctttgcagtgactgaaaatgta
gtcaatctctatcagaactatagtgagctcatcccagggaccacagttggggttctgtcc
atggattccagcaatgtcctccagctcattgttgatgcttatgggaaaatccgttctaaa
gtagagctggaagtgcgtgacctccctgaagagttgtctctatccttcaatgccacctgc
ctcaacaatgaggtcatccctggcctcaagtcttgtatgggactcaagattggagacacg
gtgagcttcagcattgaggccaaggtgcgaggctgtccccaggagaaggagaagtccttt
accataaagcccgtgggcttcaaggacagcctgatcgtccaggtcacctttgattgtgac
tgtgcctgccaggcccaagctgaacctaatagccatcgctgcaacaatggcaatgggacc
tttgagtgtggggtatgccgttgtgggcctggctggctgggatcccagtgtgagtgctca
gaggaggactatcgcccttcccagcaggacgaatgcagcccccgggagggtcagcccgtc
tgcagccagcggggcgagtgcctctgtggtcaatgtgtctgccacagcagtgactttggc
aagatcacgggcaagtactgcgagtgtgacgacttctcctgtgtccgctacaagggggag
atgtgctcaggccatggccagtgcagctgtggggactgcctgtgtgactccgactggacc
ggctactactgcaactgtaccacgcgtactgacacctgcatgtccagcaatgggctgctg
tgcagcggccgcggcaagtgtgaatgtggcagctgtgtctgtatccagccgggctcctat
ggggacacctgtgagaagtgccccacctgcccagatgcctgcacctttaagaaagaatgt
gtggagtgtaagaagtttgaccggggagccctacatgacgaaaatacctgcaaccgttac
tgccgtgacgagattgagtcagtgaaagagcttaaggacactggcaaggatgcagtgaat
tgtacctataagaatgaggatgactgtgtcgtcagattccagtactatgaagattctagt
ggaaagtccatcctgtatgtggtagaagagccagagtgtcccaagggccctgacatcctg
gtggtcctgctctcagtgatgggggccattctgctcattggccttgccgccctgctcatc
tggaaactcctcatcaccatccacgaccgaaaagaattcgctaaatttgaggaagaacgc
gccagagcaaaatgggacacagccaacaacccactgtataaagaggccacgtctaccttc
accaatatcacgtaccggggcacttaa

DBGET integrated database retrieval system